Property Summary

NCBI Gene PubMed Count 19
PubMed Score 12.59
PubTator Score 8.42

Knowledge Summary

Patent (832)

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7933 1.2e-07
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Epidermodysplasia verruciformis 21 4.185 2.1

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.567 1.2e-07

Gene RIF (1)

PMID Text
18259073 Autozygosity by descent analysis of 2 markers bordering the TMC2 gene allowed us to rule out its association with deafness within these families.

AA Sequence

MSHQVKGLKEEARGGVKGRVKSGSPHTGDRLGRRSSSKRALKAEGTPGRRGAQRSQKERAGGSPSPGSPR      1 - 70
RKQTGRRRHREELGEQERGEAERTCEGRRKRDERASFQERTAAPKREKEIPRREEKSKRQKKPRSSSLAS     71 - 140
SASGGESLSEEELAQILEQVEEKKKLIATMRSKPWPMAKKLTELREAQEFVEKYEGALGKGKGKQLYAYK    141 - 210
MLMAKKWVKFKRDFDNFKTQCIPWEMKIKDIESHFGSSVASYFIFLRWMYGVNLVLFGLIFGLVIIPEVL    211 - 280
MGMPYGSIPRKTVPRAEEEKAMDFSVLWDFEGYIKYSALFYGYYNNQRTIGWLRYRLPMAYFMVGVSVFG    281 - 350
YSLIIVIRSMASNTQGSTGEGESDNFTFSFKMFTSWDYLIGNSETADNKYASITTSFKESIVDEQESNKE    351 - 420
ENIHLTRFLRVLANFLIICCLCGSGYLIYFVVKRSQQFSKMQNVSWYERNEVEIVMSLLGMFCPPLFETI    421 - 490
AALENYHPRTGLKWQLGRIFALFLGNLYTFLLALMDDVHLKLANEETIKNITHWTLFNYYNSSGWNESVP    491 - 560
RPPLHPADVPRGSCWETAVGIEFMRLTVSDMLVTYITILLGDFLRACFVRFMNYCWCWDLEAGFPSYAEF    561 - 630
DISGNVLGLIFNQGMIWMGSFYAPGLVGINVLRLLTSMYFQCWAVMSSNVPHERVFKASRSNNFYMGLLL    631 - 700
LVLFLSLLPVAYTIMSLPPSFDCGPFSGKNRMYDVLQETIENDFPTFLGKIFAFLANPGLIIPAILLMFL    701 - 770
AIYYLNSVSKSLSRANAQLRKKIQVLREVEKSHKSVKGKATARDSEDTPKSSSKNATQLQLTKEETTPPS    771 - 840
ASQSQAMDKKAQGPGTSNSASRTTLPASGHLPISRPPGIGPDSGHAPSQTHPWRSASGKSAQRPPH        841 - 906
//

Text Mined References (19)

PMID Year Title
25114259 2014 Tip-link protein protocadherin 15 interacts with transmembrane channel-like proteins TMC1 and TMC2.
25074487 2015 Transmembrane channel-like (TMC) genes are required for auditory and vestibular mechanosensation.
24981230 2014 Conductance and block of hair-cell mechanotransducer channels in transmembrane channel-like protein mutants.
24423408 2014 TMC function in hair cell transduction.
24127526 2013 The role of transmembrane channel-like proteins in the operation of hair cell mechanotransducer channels.
23871232 2013 TMC1 and TMC2 are components of the mechanotransduction channel in hair cells of the mammalian inner ear.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22105165 2011 Perception of sound and gravity by TMC1 and TMC2.
21408207 2011 Differential genetic associations for systemic lupus erythematosus based on anti-dsDNA autoantibody production.
18259073 2008 TMC1 but not TMC2 is responsible for autosomal recessive nonsyndromic hearing impairment in Tunisian families.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12906855 2003 Characterization of the transmembrane channel-like (TMC) gene family: functional clues from hearing loss and epidermodysplasia verruciformis.
12812529 2003 TMC and EVER genes belong to a larger novel family, the TMC gene family encoding transmembrane proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11850618 2002 Dominant and recessive deafness caused by mutations of a novel gene, TMC1, required for cochlear hair-cell function.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11076863 2000 DNA cloning using in vitro site-specific recombination.