Property Summary

NCBI Gene PubMed Count 19
PubMed Score 6.67
PubTator Score 4.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

 GO Function (1)

Gene RIF (5)

AA Sequence

MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPG      1 - 70
HGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIFTFVEPVSAFVRRNVAVYYVS     71 - 140
YAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTGTISSMYQTKAVIIAMIITAVVSISVTIFCF    141 - 210
QTKVDFTSCTGLFCVLGIVLLVTGIVTSIVLYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTI    211 - 280
SPEDYITGALQIYTDIIYIFTFVLQLMGDRN                                           281 - 311
//

Text Mined References (22)

PMID Year Title