Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.31
PubTator Score 4.69

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q969X1 B3KQY6 Q8N1R3 Q8TAM3 Q96K13
Symbols LFG3
RECS1
MST100
PP1201
MSTP100

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

Gene RIF (3)

PMID Text
25764978 These results suggest that the TMBIM family has comparable functions in the maintenance of intracellular Ca(2) homeostasis in a wide variety of tissues
21107705 data suggest that PP1201 functions as an anti-apoptotic protein and its increased expression in vascular cells can contribute to homeostasis by reducing Fas trafficking to the cell membrane
18440869 The tmbim1 may participate in cell death regulation by interacting with proteins of Bcl-2 family, promoting tumor metastasis, which is deduced from the evolutionary conservation of the membrane protein family containing multiple membrane spanning segments

AA Sequence

MSNPSAPPPYEDRNPLYPGPPPPGGYGQPSVLPGGYPAYPGYPQPGYGHPAGYPQPMPPTHPMPMNYGPG      1 - 70
HGYDGEERAVSDSFGPGEWDDRKVRHTFIRKVYSIISVQLLITVAIIAIFTFVEPVSAFVRRNVAVYYVS     71 - 140
YAVFVVTYLILACCQGPRRRFPWNIILLTLFTFAMGFMTGTISSMYQTKAVIIAMIITAVVSISVTIFCF    141 - 210
QTKVDFTSCTGLFCVLGIVLLVTGIVTSIVLYFQYVYWLHMLYAALGAICFTLFLAYDTQLVLGNRKHTI    211 - 280
SPEDYITGALQIYTDIIYIFTFVLQLMGDRN                                           281 - 311
//

Text Mined References (20)

PMID Year Title
25764978 2015 The transmembrane Bax inhibitor motif (TMBIM) containing protein family: Tissue expression, intracellular localization and effects on the ER CA²?-filling state.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21107705 2011 A shear stress responsive gene product PP1201 protects against Fas-mediated apoptosis by reducing Fas expression on the cell surface.
19784873 2009 LFG: a candidate apoptosis regulatory gene family.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
18440869 2008 Comparative genomics and function analysis on BI1 family.
18088087 2008 Phosphoproteome of resting human platelets.
17897319 2007 Integral and associated lysosomal membrane proteins.
16636500 2006 RECS1 is a negative regulator of matrix metalloproteinase-9 production and aged RECS1 knockout mice are prone to aortic dilation.
16607040 2006 RECS1 deficiency in mice induces susceptibility to cystic medial degeneration.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15278903 2004 Identification of differentially regulated genes in bovine blastocysts using an annealing control primer system.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11996952 2002 Large scale isolation of non-uniform shear stress-responsive genes from cultured human endothelial cells through the preparation of a subtracted cDNA library.