Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.09
PubTator Score 0.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 8.7e-03
Breast cancer 3.000 2.5e-02
colon cancer 1.200 7.0e-04
glioblastoma 1.300 1.6e-04
group 4 medulloblastoma 1.400 1.0e-03
hepatocellular carcinoma 1.500 7.6e-05
lung cancer 1.800 5.6e-03
medulloblastoma, large-cell 2.300 3.9e-04
nasopharyngeal carcinoma 1.300 5.2e-04
pancreatic cancer 1.200 8.5e-03
pancreatic carcinoma 1.200 8.5e-03
pediatric high grade glioma 1.300 1.1e-03

Synonym

Accession Q96EY4 Q0P6E4 Q0P6J1 Q9NUR7
Symbols C4orf43

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MPKAPKGKSAGREKKVIHPYSRKAAQITREAHKQEKKEKLKNEKALRLNLVGEKLQWFQNHLDPQKKRYS      1 - 70
KKDACELIERYLNRFSSELEQIELHNSIRDRQGRRHCSRETVIKQTMERERQQFEGYGLEIPDILNASNL     71 - 140
KTFREWDFDLKKLPNIKMRKICANDAIPKTCKRKTIITVDQDLGELELNDESSDSDEEMTAVA           141 - 203
//

Text Mined References (10)

PMID Year Title