Property Summary

NCBI Gene PubMed Count 30
PubMed Score 28.50
PubTator Score 19.86

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
26531872 TM4SF5-miR-4697-3P- CTD-2354A18.1 may play a key role in the pathogenesis of gastric cancer
25772760 TM4SF5-positive tumors exhibited locally-increased CD44 expression, suggesting tumor cell differentiation
25627085 promotes self-renewal and circulating tumor cell properties
25268742 TM4SF5-specific monoclonal antibody has a therapeutic effect against colon cancer.
25033048 TM4SF5 interacted with CD151, and caused the internalization of CD63 from the cell surface.
24912675 TM4SF5 expression in SNU761 cells caused invasive extracellular matrix degradation negatively depending on IL-6/IL-6 receptor signaling.
23633159 TM4SF5 is positively associated with esophageal cancer invasiveness
23077174 Findings demonstrate that TM4SF5 directly binds to and activates FAK in an adhesion-dependent manner, to regulate cell migration and invasion in hepatocellular carcinoma.
22292774 results indicate that TGFbeta1- and growth factor-mediated signalling activities mediate TM4SF5 expression leading to acquisition of mesenchymal cell features, suggesting that TM4SF5 induction may be involved in the development of liver pathologies
22178131 Results indicate that TM4SF5-mediated epithelial-mesenchymal transition may have an important function in the gefitinib resistance of cancer cells.
22014979 involvement of JNKs in TM4SF5-mediated p27(Kip1) Ser10 phosphorylation and localization during epithelial-mesenchymal transition.
21328452 TM4SF5 expression appeared to cause loss of cell-cell adhesions via proteasome suppression and thereby proteasome inhibition
21196261 TM4SF5 plays a central regulatory role in a wide variety of physiological processes through cross-talk with integrins.[review]
20506553 Data show that TM4SF5 expression facilitated migration, invadopodia formation, MMP activation, invasion, and eventually lung metastasis in vitro and in nude mice, but suppression of TM4SF5 with its shRNA blocked the effects.
20399237 Data suggest that TM4SF5 accelerates G1/S phase progression with facilitated CDK4/cyclin D1 entry into the nucleus, which might be supported by TM4SF5-mediated actin reorganization through cytosolic p27Kip1 expression and Rho GTPase activity.
19789264 TM4SF5 in hepatocytes negatively regulates integrin alpha2 function via an interaction between the extracellular loop 2 of TM4SF5 and integrin alpha2 during cell spreading on and migration through collagen I environment
19036703 TM4SF5 facilitates angiogenesis of neighboring endothelial cells through VEGF induction, mediated by cooperation between TM4SF5 and integrin alpha(5) of epithelial cells
18357344 observations have revealed a role for TM4SF5 in causing uncontrolled growth of human hepatocarcinoma cells through epithelial-mesenchymal transition
16828471 The ectopic expression of TM4SF5 in Cos7 cells reduced integrin signaling under serum-containing conditions, but increased integrin signaling upon serum-free replating on substrates.

AA Sequence

MCTGKCARCVGLSLITLCLVCIVANALLLVPNGETSWTNTNHLSLQVWLMGGFIGGGLMVLCPGIAAVRA      1 - 70
GGKGCCGAGCCGNRCRMLRSVFSSAFGVLGAIYCLSVSGAGLRNGPRCLMNGEWGYHFEDTAGAYLLNRT     71 - 140
LWDRCEAPPRVVPWNVTLFSLLVAASCLEIVLCGIQLVNATIGVFCGDCRKKQDTPH                 141 - 197
//

Text Mined References (30)

PMID Year Title
26531872 2015 TM4SF5-CTD-2354A18.1-miR-4697-3P may play a key role in the pathogenesis of gastric cancer.
26404468 2015 Transmembrane 4 L Six Family Member 5 (TM4SF5)-Mediated Epithelial-Mesenchymal Transition in Liver Diseases.
25772760 2015 Self-renewal and circulating capacities of metastatic hepatocarcinoma cells required for collaboration between TM4SF5 and CD44.
25627085 2015 Interaction of tetraspan(in) TM4SF5 with CD44 promotes self-renewal and circulating capacities of hepatocarcinoma cells.
25268742 2014 Therapeutic effect of a TM4SF5-specific monoclonal antibody against colon cancer in a mouse model.
25033048 2014 Correlations between transmembrane 4 L6 family member 5 (TM4SF5), CD151, and CD63 in liver fibrotic phenotypes and hepatic migration and invasive capacities.
24912675 2014 Cross talk between the TM4SF5/focal adhesion kinase and the interleukin-6/STAT3 pathways promotes immune escape of human liver cancer cells.
23633159 2013 A high level of TM4SF5 is associated with human esophageal cancer progression and poor patient survival.
23077174 2012 Tetraspan TM4SF5-dependent direct activation of FAK and metastatic potential of hepatocarcinoma cells.
22916037 2012 Novel Loci for metabolic networks and multi-tissue expression studies reveal genes for atherosclerosis.
22359512 2012 Genome-wide association study identifies novel loci associated with circulating phospho- and sphingolipid concentrations.
22292774 2012 Cross-talk between TGF?1 and EGFR signalling pathways induces TM4SF5 expression and epithelial-mesenchymal transition.
22178131 2012 Gefitinib resistance of cancer cells correlated with TM4SF5-mediated epithelial-mesenchymal transition.
22014979 2012 JNK signaling activity regulates cell-cell adhesions via TM4SF5-mediated p27(Kip1) phosphorylation.
21328452 2011 Proteasome inhibition causes epithelial-mesenchymal transition upon TM4SF5 expression.
21196261 2011 Modulation of signaling between TM4SF5 and integrins in tumor microenvironment.
20506553 2010 Transmembrane 4 L six family member 5 (TM4SF5) enhances migration and invasion of hepatocytes for effective metastasis.
20399237 2010 TM4SF5 accelerates G1/S phase progression via cytosolic p27Kip1 expression and RhoA activity.
19789264 2009 The extracellular loop 2 of TM4SF5 inhibits integrin alpha2 on hepatocytes under collagen type I environment.
19036703 2009 Cooperation between integrin alpha5 and tetraspan TM4SF5 regulates VEGF-mediated angiogenic activity.
18357344 2008 Tetraspanin TM4SF5 mediates loss of contact inhibition through epithelial-mesenchymal transition in human hepatocarcinoma.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16828471 2006 Focal adhesion and actin organization by a cross-talk of TM4SF5 with integrin alpha2 are regulated by serum treatment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11774983 2001 Amount of expression of the tumor-associated antigen L6 gene and transmembrane 4 superfamily member 5 gene in gastric cancers and gastric mucosa.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
10975581 2000 The L6 membrane proteins--a new four-transmembrane superfamily.
9479038 1998 Identification of a new tumour-associated antigen TM4SF5 and its expression in human cancer.
8895530 1996 A pancreatic cancer-specific expression profile.