Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.36
PubTator Score 9.85

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -3.500 1.4e-08
intraductal papillary-mucinous adenoma (... -2.500 3.7e-02
lung adenocarcinoma 1.400 4.6e-03
lung carcinoma 1.900 9.0e-06

Synonym

Accession P48230 B2RDA4
Symbols ILTMP
il-TMP

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
25344917 TM4SF4 expression was correlated with the increased expression of IGF1, consequently resulting in IGF1R activation in lung adenocarcinoma.
24282057 TM4SF4 interacts with hTHTR-2 and influences the physiological function of the thiamine transporter in human intestinal epithelial cells.
23296076 TM4SF4 is a membrane protein that may have a role in attenuating liver cancer cell growth
22011044 Results suggest that S100B, TM4SF3, and OLFM4 overexpression may affect metastatic behavior of tumor cells in Taiwanese colorectal cancer patients.
18765015 expression of transmembrane 4 superfamily member 4 (TM4SF4) and matrix metalloproteinase 26 (MMP26) was found to be significantly decreased during the implantation window in patients with polycystic ovary syndrome.

AA Sequence

MCTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGGILGSGVLMIFPALVFLGLK      1 - 70
NNDCCGCCGNEGCGKRFAMFTSTIFAVVGFLGAGYSFIISAISINKGPKCLMANSTWGYPFHDGDYLNDE     71 - 140
ALWNKCREPLNVVPWNLTLFSILLVVGGIQMVLCAIQVVNGLLGTLCGDCQCCGCCGGDGPV            141 - 202
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25344917 2014 TM4SF4 overexpression in radiation-resistant lung carcinoma cells activates IGF1R via elevation of IGF1.
24282057 2014 Association of TM4SF4 with the human thiamine transporter-2 in intestinal epithelial cells.
23296076 2013 Adenovirus-mediated delivery of siRNA targeting TM4SF4 attenuated liver cancer cell growth in vitro and in vivo.
22011044 2012 Overexpression of S100B, TM4SF4, and OLFM4 genes is correlated with liver metastasis in Taiwanese colorectal cancer patients.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18765015 2008 Microarray evaluation of endometrial receptivity in Chinese women with polycystic ovary syndrome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739647 2001 Complexes of tetraspanins with integrins: more than meets the eye.
10975581 2000 The L6 membrane proteins--a new four-transmembrane superfamily.
9737661 1998 Pattern of expression of tetraspanin antigen genes in Burkitt lymphoma cell lines.
7665614 1995 A tetraspan membrane glycoprotein produced in the human intestinal epithelium and liver that can regulate cell density-dependent proliferation.