Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.67
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

AA Sequence

MGSRKCGGCLSCLLIPLALWSIIVNILLYFPNGQTSYASSNKLTNYVWYFEGICFSGIMMLIVTTVLLVL      1 - 70
ENNNNYKCCQSENCSKKYVTLLSIIFSSLGIAFSGYCLVISALGLVQGPYCRTLDGWEYAFEGTAGRFLT     71 - 140
DSSIWIQCLEPAHVVEWNIILFSILITLSGLQVIICLIRVVMQLSKILCGSYSVIFQPGII             141 - 201
//

Text Mined References (6)

PMID Year Title