Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.67
PubTator Score 2.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Synonym

Accession Q96CE8 B2R8K0 D3DNH5
Symbols L6D

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MGSRKCGGCLSCLLIPLALWSIIVNILLYFPNGQTSYASSNKLTNYVWYFEGICFSGIMMLIVTTVLLVL      1 - 70
ENNNNYKCCQSENCSKKYVTLLSIIFSSLGIAFSGYCLVISALGLVQGPYCRTLDGWEYAFEGTAGRFLT     71 - 140
DSSIWIQCLEPAHVVEWNIILFSILITLSGLQVIICLIRVVMQLSKILCGSYSVIFQPGII             141 - 201
//

Text Mined References (6)

PMID Year Title