Property Summary

NCBI Gene PubMed Count 4
PubMed Score 5.99
PubTator Score 3.29

Knowledge Summary


No data available


  Disease (2)


  Differential Expression (9)

Disease log2 FC p
Multiple myeloma 1.352 2.2e-03
psoriasis -1.100 1.1e-02
osteosarcoma -1.538 3.7e-05
glioblastoma -1.100 9.6e-05
medulloblastoma, large-cell -1.100 1.6e-04
subependymal giant cell astrocytoma -1.745 2.2e-02
Pick disease -1.200 6.3e-04
ovarian cancer 2.000 1.7e-03
dermatomyositis 1.800 2.1e-04

Protein-protein Interaction (11)

Gene RIF (1)

16642435 Our approach yielded 26 candidate genes differentially expressed between patients (Osteoarthritis) and controls. BLP2 and CIAS1 seem to be trans-regulated, as the absence of allelic expression imbalances suggests.

AA Sequence

EGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI                                     211 - 247

Text Mined References (7)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16642435 2006 Cis- and trans-acting gene regulation is associated with osteoarthritis.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11278849 2001 beta -Amyloid peptide-induced apoptosis regulated by a novel protein containing a g protein activation module.