Property Summary

NCBI Gene PubMed Count 5
PubMed Score 6.32
PubTator Score 3.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (9)

Disease log2 FC p
dermatomyositis 1.800 2.1e-04
glioblastoma -1.100 9.6e-05
medulloblastoma, large-cell -1.100 1.6e-04
Multiple myeloma 1.352 2.2e-03
osteosarcoma -1.538 3.7e-05
ovarian cancer -1.400 5.6e-04
Pick disease -1.200 6.3e-04
psoriasis -1.100 1.1e-02
subependymal giant cell astrocytoma -1.745 2.2e-02

Protein-protein Interaction (11)

Gene RIF (2)

AA Sequence

MAGGVLPLRGLRALCRVLLFLSQFCILSGGEQSQALAQSIKDPGPTRTFTVVPRAAESTEIPPYVMKCPS      1 - 70
NGLCSRLPADCIDCTTNFSCTYGKPVTFDCAVKPSVTCVDQDFKSQKNFIINMTCRFCWQLPETDYECTN     71 - 140
STSCMTVSCPRQRYPANCTVRDHVHCLGNRTFPKMLYCNWTGGYKWSTALALSITLGGFGADRFYLGQWR    141 - 210
EGLGKLFSFGGLGIWTLIDVLLIGVGYVGPADGSLYI                                     211 - 247
//

Text Mined References (8)

PMID Year Title