Property Summary

NCBI Gene PubMed Count 185
PubMed Score 580.95
PubTator Score 285.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
pancreatic cancer 1.100 4.4e-03
astrocytoma 1.600 4.0e-02
glioblastoma 1.300 3.5e-02
tuberculosis 1.500 1.8e-02
intraductal papillary-mucinous adenoma (... 1.400 2.5e-02
lung cancer -2.300 7.5e-05
adult high grade glioma 1.100 2.0e-02
pancreatic carcinoma 1.100 4.4e-03
subependymal giant cell astrocytoma 1.946 8.8e-03
mucosa-associated lymphoid tissue lympho... 1.723 4.7e-02
pituitary cancer -1.300 2.6e-04

Gene RIF (166)

PMID Text
26695672 TLR2 and 5 polymorphisms (rs5743708, rs3804099 and rs5744105) may not serve as the susceptible gene for sepsis in newborn infants.
26645913 These results indicate that in response to Pseudomonas aeruginosa or flagellin, EGFR associates with and tyrosine phosphorylates MUC1-CT in primary normal human bronchial epithelial cells, leading to increased MUC1-CT association with TLR5
26615831 Study elucidated the relationship between TLR5 and caveolin-1 at the transcriptional and translational levels using human cells, results suggest that caveolin-1 is a crucial regulator for maintaining and controlling TLR5 expression.
26548862 Study showed that MyD88 Toll/interleukin-1 receptor (TIR) domain interacted with TLR5TIR but not with TLR6TIR. The solubility of both TLR5TIR and TLR6TIR were influenced by its binding partner MyD88TIR. Moreover, TLR5TIR exhibited increased solubility.
26220208 p53-dependent amplification of transcriptional response to TLR5 activation required expression of NFkappaB subunit p65 and was mediated by several molecular mechanisms
25995217 genetic polymorphism is not associated with duodenal ulcer
25862837 TLR 2, 4, 5, 7 and 9 appear to reflect certain clinicopathological variables and prognostic markers of MCC tumors
25789623 TLR5 variants R392X and N592S showed significant association with UC patients but TLR 1, 2, 3, 6 variants did not show any association.
25789623 Association of TLR5 Gene Polymorphisms in Ulcerative Colitis Patients of North India and Their Role in Cytokine Homeostasis.
25611816 Establishing bacterial flagellin-recognizing toll-like receptor 5 (TLR5) as a novel link between gut microbiota composition, adipose tissue inflammation, and obesity.
25603867 Flagellin activated TLR5 protein in non-small cell lung cancer cell lines and initiate downstream signaling pathways.
25563498 MAMs MUC1 and MUC16 contribute to the maintenance of immune homeostasis at the ocular surface by limiting TLR-mediated innate immune responses.
25549591 expression is increased in both maternal part and fetal part of the placenta in Iranian women with preeclampsia
25533336 Study demonstrates that TLR5 recognition of commensal microbiota regulates systemic tumor-promoting inflammation and, subsequently, extramucosal malignant progression.
25378591 Intestinal expression of Fas and Fas ligand is upregulated by bacterial signaling through TLR4 and TLR5, with activation of Fas modulating intestinal TLR-mediated inflammation.
25284610 review of recent research on the interactions between TLR5, adaptive immunity and the microbiota; discussion of how variation in the TLR5 gene may alter these interactions to impact host inflammatory phenotypes in humans
25057020 TLR2- and TLR5-triggered integrin activation in leukocytes required enhanced Rap1 GTPase activity, which was mediated by Rac1 activation and NADPH oxidase-2-dependent reactive oxygen species production.
25047824 TLR-5 was more abundant in OSCC than in CSCC samples.
24901824 A family was heterozygous for risk variants of the genes encoding NOD2 and TLR5 and homozygous carriers of PTPN2 risk alleles in Crohn disease.
24882571 Attenuated TLR2, TLR4, and TLR5 in middle ear mucosa contribute to susceptibility of chronic suppurative otitis media.
24881544 Studies indicate that toll-like receptor 5 (TLR5) specifically interacts with flagellin, and is useful as an analytical recognition element for low concentrations of flagellin.
24861338 mediates cytokine production in response to the Toxoplasma gondii-derived profilin
24830583 Genetic polymorphisms in TLR5 might be associated with decreased susceptibility of Graves' disease in Chinese Cantonese females.
24709011 TLR5 activation by flagellin may elicit chemoresistance in Multiple myeloma patients who have suffered from recurrent bacterial infections.
24549739 Low expression of TLR5 was associated with non-small cell lung cancer.
24447081 results reveal broad expression patterns of TLR5 and TLR7 in the lung and that the expression is decreased in severe asthma.
24221343 suggest a role for abnormal expression of TLR5 in the pathogenesis of esophageal adenocarcinoma and suggest importance of altered microbiome in the pathogenesis of complications of Barrett's esophagus
24154872 Frequent SNP's in the flagellin receptor TLR5 and the TLR downstream effector molecules MyD88 and TIRAP that are associated with altered survival in a large cohort of Caucasian patients with colorectal cancer
24128895 exposure of human T cells to flagellin leads to a transient TLR5-induced increase in the sensitivity of these cells to subsequent TCR activation.
23867959 TLR5(rs5744105)variant was associated with altered immune responses in very low birth weight infants (elevated WBC counts)during bacterial infections.
23862689 Authors suggest that TLR5 is involved in host defense against Aspergillus fumigatus, and that the recipient TLR5-Stop SNP represents a risk factor for the development of invasive aspergillosis after allogeneic stem cell transplantation.
23844139 TLR5 signaling enhances the proliferation of human allogeneic CD40-activated B cell induced CD4hiCD25+ regulatory T cells.
23666857 Our data demonstrate a novel role for TLR-5 in rheumatoid arthritis angiogenesis; thus, TLR-5 may be a promising new target for its treatment.
23624387 Data indicate the biological activity of a TLR5:flagellin complex with a 2:2 stoichiometry.
23593463 A non-synonymous coding variant (L616F) in the TLR5 gene is potentially associated with Crohn's disease and influences responses to bacterial flagellin.
23534905 These findings demonstrate that IL-32 is induced by microbial ligands through TLR-mediated innate signaling pathways, suggesting an important role of corneal epithelium in inflammatory disease.
23526294 Studied if SNPs in TLR 2, 4 and 5 affect susceptibility of L. pneumophila infection in a Han Chinese population by in vitro assay. 54 healthy subjects were genotyped for TLR SNPs. PBMCs from these subjects and stimulated with live L. pneumophila for 24 h.
23455496 A nonsense polymorphism (R392X) in TLR5 protects from obesity but predisposes to diabetes.
23447684 Impaired TLR5 functionality is associated with survival in melioidosis.
23437263 C. concisus infection in HT-29 cells did not affect the expression of TLR2 and TLR5.
23333304 HIV-1 Vif downregulates the expression of toll-like receptor 5 (TLR5) in Vif-expression T cells
23287987 High expression of TLR5 is associated with recurrence in squamous cell carcinoma of the tongue
23261530 Clostridium difficile flagellin stimulates toll-like receptor 5, and toxin B promotes flagellin-induced chemokine production via TLR5.
23121969 The cooperation of TLR5 and Nod2 in intestinal epithelial cells regulates inflammatory response to Salmonella infection.
23104900 These results indicate that polyethylenimine is a new TLR5 agonist with potential application in offering protection for patients receiving radiotherapy or in radiation-related accidents.
23068105 Inactivation of mucA (the gene responsible for the mucoid phenotype) in PAO1 leads to p38alpha MAPK activation by both TLR2 and TLR5, as observed in the cystic fibrosis clinical mucoid isolate PACF508.
23064463 Toll-like receptor 5 (TLR5), the mammalian receptor for FLA, was required for priming strong allergic responses to natural indoor allergens present in house dust extracts .
22994872 Data suggest that activation of TLR5 upregulates IL17C expression in intestinal mucosa cells and colon adenocarcinoma cells; MyD88 and TRIF adaptor molecules appear to be involved in TLR5-mediated upregulation of IL17C expression.
22855713 TLR5 is expressed mainly on the apical side of the airway epithelium and is decreased in healthy smokers and smokers with chronic obstructive pulmonary disease (COPD).
22703024 The results showed that the genetic markers in TLR1, TLR4, TLR5 TLR6, and TLR10 were associated with the occurrence of acute Graft-versus-host disease following hematopoietic stem cell transplantation
22661088 TLR5 ligation has a potential role in modulating transcription of tumor necrosis factor (TNF)-alpha in rheumatoid arthritis (RA) synovial fluid, strongly correlating TLR5 and TNF-alpha with each other and with RA disease activity in peripheral blood monocytes.
22250084 epidermal growth factor receptor tyrosine phosphorylates MUC1, leading to an increase in its association with TLR5, thereby competitively and reversibly inhibiting recruitment of MyD88 to TLR5 and downstream signaling events.
22173220 The asymmetry of the dimer suggests that TLR5 may recognize two flagellin molecules cooperatively to establish an optimal flagellin response threshold.
22058078 The TLR5 (g.1174C > T) variant was associated with bronchopulmonary dysplasia.In regression models that controlled for potential epidemiological confounders, the TLR5 variant was associated with severe bronchopulmonary dysplasia.
21994405 TLR5 polymorphism may play important roles in the process of H. pylori-related gastric carcinogenesis
21949773 The novel findings in this study show that luminal-applied flagellin is internalized by normal intestinal epithelial cell via TLR5.
21721932 None of the investigated SNPs clearly predicted outcome of sepsis-related multiorgan failure.
21714724 DUOX2 plays pivotal roles in TLR5-dependent inflammatory response of nasal airway epithelium.
21573018 H. pylori triggered enhanced TLR-2 and TLR-5 expression and IL-8 and TNF-alpha cytokine secretion in THP-1 cells was induced in a cag pathogenicity island-dependent manner.
21455638 Increased expression of toll-like receptor 5 is associated with gastric dysplasia.
21455558 These findings suggest that TLR5 may play an important role in tumor progression of gastric cancer via the regulation of cell proliferation.
21237205 demonstrate that all-trans retinoic acid (ATRA) significantly up-regulated TLR-5 expression in human macrophage THP-1 cells by co-activating NF-kappaB and the RARalpha receptor
21204905 The enteropathogenic Escherichia coli adhesive protein intimin modulates TLR5 activation in intestinal epithelial cells (IEC). Intimate adherence of bacteria to IEC alters the proinflammatory response.
21109746 Flagellin induces TSLP expression in keratinocytes via TLR5 and the expression can be upregulated by a cytokine milieu with Th2/TNF-alpha or TGF-alpha.
21068401 genetic variation in TLR5 resulting in reduced flagellin responsiveness is associated with improved health indicators in adults with CF.
21068401 Observational study of gene-disease association. (HuGE Navigator)
21067314 THP-1 monocytes treated with silencing RNA against TLR5 display increased ability to reduce conidial viability. TLR5 activation by flagellin reduces these cells' ability to inactivate conidia.
20977567 Observational study of gene-disease association. (HuGE Navigator)
20953381 the p110alpha and beta isoforms of class IA PI3K are both required for the proinflammatory response to flagellin via TLR5
20952467 Peripheral blood cell gene expression profiling in ankylosing spondylitis shows an upregulation of TLR4 and TLR5.
20855887 Silencing TRIF expression reduces TLR5-induced NFkappaB, JNK1/2, and ERK1/2 activation in human colonic epithelial cells.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20656790 investigation of role of TLR5 in implantation using in vitro coculture model: activation of TLR5 may inhibit adhesion of trophoblast cells to endometrial cells and may thus result in implantation failure
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20626741 Observational study of gene-disease association. (HuGE Navigator)
20604744 Observational study of gene-disease association. (HuGE Navigator)
20595247 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20483744 these data show for the first time that TLR3 and TLR5 stimulation of human prostate cancer cells triggers the production of chemokines
20463618 Observational study of gene-disease association. (HuGE Navigator)
20456615 Results showed that TLR5 was functionally expressed in YD-10B cells, but did not influence cell proliferation, migration, invasion, and angiogenesis.
20452988 TRIF modulates TLR5-dependent responses by inducing proteolytic degradation of TLR5
20452482 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20364327 SIGIRR can inhibit TLR4, 5, and 9-mediated immune responses in human airway epithelial cells.
20227302 Observational study of gene-disease association. (HuGE Navigator)
20196781 TLR4 and 5 signalling in unrestricted somatic stem cells is slow and results in the up-regulation of a restricted number of pro-inflammatory cytokines and enhanced osteoblastic differentiation
20194452 Observational study of gene-disease association. (HuGE Navigator)
20164175 Introduction of multiple defined regions from Salmonella flagellin into C. jejuni FlaA revealed three regions critical for the activation of human and mouse TLR5, including a beta-hairpin structure not previously implicated in TLR5 recognition.
20154223 Infection with Legionella pneumophila markedly increased beta-defensin-2 production, and the response was attenuated in Toll-like receptor (TLR) 2 and TLR5 transient knockdown cells.
20130217 Data show that Sigirr overexpression depresses NF-B-mediated diverse TLR responses.
20100933 Studies show substantial decreases in older compared with young individuals in cytokine production in response to TLR1/2, TLR6, TLR3, TLR5, and TLR8, TLR7 and TLR9 in DCs.
20083854 down-regulation of TLR-5 is probably caused by the increased number of ligand molecules in the proximity of epithelial cells in the inflamed tissue
20056178 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20016852 Observational study of gene-disease association. (HuGE Navigator)
19950169 Data demonstrate that PKC-alpha is induced by several MyD88-dependent TLR/IL-1R ligands and regulates cytokine expression in human and murine DC.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19912257 Data show that the gene expressions of TLR-4 and TLR-5 in human cultured HCT-15 and HT-29 cells were confirmed by RT-PCR.
19828626 Sle1 transgene perturbs the action of peripheral tolerance checkpoints operative on antinuclear antigen B cells in both the antibody-forming cell and germinal center pathways in a cell autonomous fashion.
19786303 Flagellin-induced IL-8 expression requires formation of lipid rafts, intracellular TLR activation, and subsequent activation of PKC and MAP kinases leading to the activation of the transcription factors NF-kappaB and NF-IL6.
19758322 Activation of TLR2, TLR3 or TLR5 induces the expression of MMP-1 and MMP-9 in human epidermal keratinocytes.
19638314 Observational study of gene-disease association. (HuGE Navigator)
19620771 Polyethylenimine-based siRNA nanocomplexes reprogram tumor-associated dendritic cells via TLR5 to elicit therapeutic antitumor immunity.
19616328 Genetic variants of TLR5 gene are associated with rheumatic heart disease in Chinese Han population.
19616328 Observational study of gene-disease association. (HuGE Navigator)
19543401 polymorphisms in TLRs 1, 4, and 5 are associated with altered risks of urinary tract infections in adult women
19543401 Observational study of gene-disease association. (HuGE Navigator)
19505919 Observational study of gene-disease association. (HuGE Navigator)
19473567 there were no statistically significant differences between the allele and genotype distribution of TLR5 (toll-like receptor 5) rs5744168 and TLR7 (toll-like receptor 7) rs179008 polymorphisms in Systemic lupus erythematosus patients and controls
19473567 Observational study of gene-disease association. (HuGE Navigator)
19447460 TLR5 triggering induces activation of NF-kappaB, HIV-1 promoter and viral regulatory sequences to reactivate latent HIV-1 provirus.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19179655 Study found that one mutation that abolishes TLR5 function is present at high frequencies in many human populations; this mutation is not young, and its high frequency suggests some functional redundancy for this pattern-recognition receptor in humans.
19150884 Toll-like receptors 4 and 5 induce distinct types of vasculitis.
19134113 enteropathogenic E. coli can trigger mucosal IL-8 responses by apical flagellin/TLR5 interaction ex vivo and does not require access to the basolateral membrane as postulated in cell culture models.
19120490 polymorphism is associated with susceptibility to pneumonia caused by the flagellated bacterium Legionella pneumophila
19067129 lower expression in asthmatic patients
18809506 Observational study of gene-disease association. (HuGE Navigator)
18776592 Observational study of gene-disease association. (HuGE Navigator)
18686608 Human epidermal keratinocytes constitutively express all TLR 1-10 mRNA, which may enable human keratinocytes to respond to a wide range of pathogenic micro-organisms.
18684966 Toll-like receptor (TLR)5 is stored intracellularly in neutrophils and is mobilized to the cell surface in a protein synthesis-independent manner after stimulation with TLR ligands and cytokines characteristic of cystic fibrosis airway microenvironment.
18680520 TLR5, but neither TLR2 nor TLR4, critically regulated Brukholderia cenocepacia-induced lung epithelial inflammatory response.
18590761 mutation at position 1174 in the coding sequence is associated with Legionnaires' disease and is negatively associated with the occurrence of Crohn's disease
18538140 Toll-like receptor 5 engagement modulates tumor development and growth in a mouse xenograft model of human colon cancer.
18490781 study demonstrated that TLR signaling appears to mediate the excessive cytokine production occurring in cystic fibrosis; inhibition of TLR5 abolished the damaging inflammatory response generated by CF airway cells following exposure to P. aeruginosa
18325643 Observational study of gene-disease association. (HuGE Navigator)
18314303 FlaA of V. cholerae could induce IL-1beta expression by recognizing TLR5 that activate NF-kappaB and MAP kinase in Int407 cells.
18213697 Observational study and meta-analysis of gene-disease association and gene-gene interaction. (HuGE Navigator)
18167552 Microbial patterns signaling via Toll-like receptors 2 and 5 contribute to epithelial repair, growth and survival. This effect is independent of hematopoietic and other cells as well as inflammatory cytokines
17703412 Observational study of gene-disease association. (HuGE Navigator)
17587322 TLR5 may play a significant role in tumor progression of cervical neoplasia and may represent a useful marker for malignant transformation of cervical squamous cells.
17516623 Observational study of gene-disease association. (HuGE Navigator)
17516623 Our results do not indicate a major influence of these putative functional TLR5 and TLR9 single nucleotide polymorphisms on the susceptibility to (or protection from) systemic lupus erythematosus.
17442957 Phosphorylation of TLR5 by PKD may be one of the proximal elements in the cellular response to flagellin, and that this event contributes to p38 MAPK activation and production of inflammatory cytokines in epithelial cells.
17283206 A conserved surface on Toll-like receptor 5 recognizes bacterial flagellin.
16971956 Observational study of gene-disease association. (HuGE Navigator)
16897777 These data suggest a critical role of NOD2/CARD15 in the bacterial clearance of the intestinal epithelium while Crohn's disease (CD)-specific mutated NOD2/CARD15 causes an impaired epithelial barrier.
16670329 TLR5's rapid activation of phosphoinositide 3-kinase serves to limit MAP kinase signaling, thus limiting proinflammatory gene expression and reducing the potential negative consequences of proinflammatory gene expression.
16644730 MyD88 bridges TLR5 engagement to PI3K activation in response to flagellin
16470719 analysis of single nucleotide polymorphisms in the human TLR5 gene
16439468 Observational study of gene-disease association. (HuGE Navigator)
16439468 These results demonstrate that natural acquisition of immune responses to flagellin are regulated by TLR5 and suggest that immune responses to flagellin are not merely associated with CD but rather promote the pathogenic response.
16339542 Costimulation of effector T cells with anti-CD3 and TLR5 ligand flagellin resulted in enhanced proliferation and production of IL-2, and potently increased their suppressive capacity and enhanced expression of FOXP3.
16284379 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16239509 the airway epithelial receptor TLR5 senses P. aeruginosa through its flagellin protein, which may have an important role in the initiation of the host inflammatory reaction to clear the invading pathogen
16179598 The interaction of TLR5 with S. typhimurium fliC in the initiation of the inflammatory and apoptotic response of gastrointestinal epithelial cells is reported.
16044857 first study describing TLR expression on tumor cells of gastric carcinoma and its precursor lesions
16027372 Observational study of gene-disease association. (HuGE Navigator)
16027372 A stop codon polymorphism of Toll-like receptor 5 is associated with resistance to systemic lupus erythematosus.
15956202 Toll-like receptor 5 has a role in survival of flagellated bacteria
15747241 Observational study of gene-disease association. (HuGE Navigator)
15731050 Helicobacter pylori induces interleukin-8 secretion by Toll-like receptor 2- and Toll-like receptor 5-dependent and -independent pathways
15685542 The memory B-cell subset expressed higher densities of TLR9 as compared with naive B cells in primary biliaary cirrhosis.
15302888 TLR5 is activated in intestinal epithelial cells by a commensal Escherichia coli strain
15135456 identification of two common single nucleotide polymorphisms
15069060 in non-transformed human colonocytes, MEK activation following flagellin/TLR5 engagement is a key modulator for NFkappaB-independent, IL-8 and MIP3alpha expression.
15067088 Microvascular endothelial cells, representing the barrier between circulating immune cells and the intestinal mucosa, functionally express TLR5, which plays a previously unrecognized role in the innate immune response toward bacterial antigens.
14707135 TLR5 has a role in promotion of hBD-2 expression via mitogen-activated protein kinase along with gangliosides and Salmonella FliC protein
14607814 Data show that flagella signaling in airway cells can be initiated by interactions with asialoGM1 and toll-like receptor (TLR)2 as well as by activation of TLR5.
12933896 TLR5 may represent an important mechanism underlying the recognition of bacterial pathogens by osteoblasts during bone infections.
12734364 By their surface expression of TLR5 and sensitivity to bacterial flagellin stimulation, with concomitant chemokine and cytokine production, dendritic cells provide a mechanism by which motile bacteria can initiate an acquired immune response.
12702497 results indicate that epithelial TLR5 mediates p38 activation and subsequently regulates flagellin-induced IL-8 expression independently of NF-kappaB, probably by influencing IL-8 mRNA translation
12600829 All nine patients expressed all of the TLRs studied, whereas only five out of the nine patients had any granulomas positive for IL-4.The associations between TLRs 1, 5, and 9 were different in IL-4-negative compared with IL-4-positive patients.
12185085 role of two nonadjacent regions in enteroaggregative Escherichia coli flagellin are required for activation
11953430 Gram-negative flagellin-induced self-tolerance is associated with a block in interleukin-1 receptor-associated kinase release from toll-like receptor 5.

AA Sequence

MGDHLDLLLGVVLMAGPVFGIPSCSFDGRIAFYRFCNLTQVPQVLNTTERLLLSFNYIRTVTASSFPFLE      1 - 70
QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFHLFELRLYFCGLSDAVLKDGY     71 - 140
FRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQIFLVCEHELEPLQGKTLSFFSLAANSLYS    141 - 210
RVSVDWGKCMNPFRNMVLEILDVSGNGWTVDITGNFSNAISKSQAFSLILAHHIMGAGFGFHNIKDPDQN    211 - 280
TFAGLARSSVRHLDLSHGFVFSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGE    281 - 350
LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPK    351 - 420
INLTANLIHLSENRLENLDILYFLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFLGENMLQLAWE    421 - 490
TELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQL    491 - 560
LAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCD    561 - 630
EEEVLKSLKFSLFIVCTVTLTLFLMTILTVTKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFS    631 - 700
SKDFTWVQNALLKHLDTQYSDQNRFNLCFEERDFVPGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLE    701 - 770
AFSYAQGRCLSDLNSALIMVVVGSLSQYQLMKHQSIRGFVQKQQYLRWPEDFQDVGWFLHKLSQQILKKE    771 - 840
KEKKKDNNIPLQTVATIS                                                        841 - 858
//

Text Mined References (188)

PMID Year Title
26695672 2015 [Association between toll-like receptors 2 and 5 polymorphisms and neonatal sepsis].
26645913 2016 Pseudomonas aeruginosa stimulates tyrosine phosphorylation of and TLR5 association with the MUC1 cytoplasmic tail through EGFR activation.
26615831 2015 Direct Regulation of TLR5 Expression by Caveolin-1.
26548862 2016 In Vitro Reconstitution of the Toll/Interleukin-1 Receptor (TIR) Domain Complex Between TLR5/6 and Myd88.
26220208 2015 p53 amplifies Toll-like receptor 5 response in human primary and cancer cells through interaction with multiple signal transduction pathways.
25995217 2015 Polymorphisms in TLR9 but not in TLR5 increase the risk for duodenal ulcer and alter cytokine expression in the gastric mucosa.
25862837 2015 The expression of Toll-like receptors 2, 4, 5, 7 and 9 in Merkel cell carcinoma.
25789623 2015 Association of TLR5 gene polymorphisms in ulcerative colitis patients of north India and their role in cytokine homeostasis.
25611816 2015 Toll-like receptor 5 in obesity: the role of gut microbiota and adipose tissue inflammation.
25603867 2015 [Expression of TLR5 in different types of non-small cell lung cancer cell lines and its activation mechanism].
25563498 2015 Suppression of Toll-like receptor-mediated innate immune responses at the ocular surface by the membrane-associated mucins MUC1 and MUC16.
25549591 2014 Differences in the expression of TLRs and inflammatory cytokines in pre-eclamptic compared with healthy pregnant women.
25533336 2015 Microbially driven TLR5-dependent signaling governs distal malignant progression through tumor-promoting inflammation.
25378591 2014 Intestinal expression of Fas and Fas ligand is upregulated by bacterial signaling through TLR4 and TLR5, with activation of Fas modulating intestinal TLR-mediated inflammation.
25284610 2014 Linking genetic variation in human Toll-like receptor 5 genes to the gut microbiome's potential to cause inflammation.
25057020 2014 A novel pathway of rapid TLR-triggered activation of integrin-dependent leukocyte adhesion that requires Rap1 GTPase.
25047824 2015 Toll-like receptors -4 and -5 in oral and cutaneous squamous cell carcinomas.
24901824 2014 A distinct pattern of disease-associated single nucleotide polymorphisms in IBD risk genes in a family with Crohn's disease.
24882571 2014 Attenuated TLRs in middle ear mucosa contributes to susceptibility of chronic suppurative otitis media.
24881544 2014 The effects of lipids and surfactants on TLR5-proteoliposome functionality for flagellin detection using surface plasmon resonance biosensing.
24861338 2014 Toxoplasma gondii- derived profilin triggers human toll-like receptor 5-dependent cytokine production.
24830583 2014 Association of TLR4 and TLR5 gene polymorphisms with Graves' disease in Chinese Cantonese population.
24709011 TLR5 activation by flagellin induces doxorubicin resistance via interleukin-6 (IL-6) expression in two multiple myeloma cells.
24549739 2014 High expression of Toll-like receptor 5 correlates with better prognosis in non-small-cell lung cancer: an anti-tumor effect of TLR5 signaling in non-small cell lung cancer.
24447081 2014 Mapping of TLR5 and TLR7 in central and distal human airways and identification of reduced TLR expression in severe asthma.
24221343 2014 Increased Toll-like receptor 5 expression indicates esophageal columnar dysplasia.
24154872 2013 Functional TLR5 genetic variants affect human colorectal cancer survival.
24128895 2014 Prior TLR5 induction in human T cells results in a transient potentiation of subsequent TCR-induced cytokine production.
23867959 2013 Toll-like receptor genetic variants are associated with Gram-negative infections in VLBW infants.
23862689 2013 TLR5 stop codon polymorphism is associated with invasive aspergillosis after allogeneic stem cell transplantation.
23844139 2013 TLR5 signaling enhances the proliferation of human allogeneic CD40-activated B cell induced CD4hiCD25+ regulatory T cells.
23666857 2013 Angiogenesis in rheumatoid arthritis is fostered directly by toll-like receptor 5 ligation and indirectly through interleukin-17 induction.
23624387 2013 Determination of the physiological 2:2 TLR5:flagellin activation stoichiometry revealed by the activity of a fusion receptor.
23593463 2013 A non-synonymous coding variant (L616F) in the TLR5 gene is potentially associated with Crohn's disease and influences responses to bacterial flagellin.
23534905 2013 TLR-mediated induction of proinflammatory cytokine IL-32 in corneal epithelium.
23526294 2013 Polymorphisms in toll-like receptors 2, 4 and 5 are associated with Legionella pneumophila infection.
23455496 2013 A nonsense polymorphism (R392X) in TLR5 protects from obesity but predisposes to diabetes.
23447684 2013 Impaired TLR5 functionality is associated with survival in melioidosis.
23437263 2013 The effects of oral and enteric Campylobacter concisus strains on expression of TLR4, MD-2, TLR2, TLR5 and COX-2 in HT-29 cells.
23287987 2013 Toll-like receptor 5 (TLR5) expression is a novel predictive marker for recurrence and survival in squamous cell carcinoma of the tongue.
23261530 2013 Clostridium difficile flagellin stimulates toll-like receptor 5, and toxin B promotes flagellin-induced chemokine production via TLR5.
23121969 Regulation of Salmonella flagellin-induced interleukin-8 in intestinal epithelial cells by muramyl dipeptide.
23104900 2013 Anti-radiation damage effect of polyethylenimine as a toll-like receptor 5 targeted agonist.
23068105 2012 Mucoid Pseudomonas aeruginosa caused by mucA mutations result in activation of TLR2 in addition to TLR5 in airway epithelial cells.
23064463 2012 The Toll-like receptor 5 ligand flagellin promotes asthma by priming allergic responses to indoor allergens.
22994872 2012 Toll-like receptor 5 engagement induces interleukin-17C expression in intestinal epithelial cells.
22855713 2012 Airway epithelial expression of TLR5 is downregulated in healthy smokers and smokers with chronic obstructive pulmonary disease.
22703024 2012 Toll-like receptor gene polymorphisms confer susceptibility to graft-versus-host disease in allogenic hematopoietic stem cell transplantation.
22661088 2012 TLR5, a novel and unidentified inflammatory mediator in rheumatoid arthritis that correlates with disease activity score and joint TNF-? levels.
22250084 2012 Membrane-tethered MUC1 mucin is phosphorylated by epidermal growth factor receptor in airway epithelial cells and associates with TLR5 to inhibit recruitment of MyD88.
22173220 2012 Toll-like receptor 5 forms asymmetric dimers in the absence of flagellin.
22058078 2012 A TLR5 (g.1174C?>?T) variant that encodes a stop codon (R392X) is associated with bronchopulmonary dysplasia.
21994405 2011 Genetic variants of toll-like receptor 2 and 5, helicobacter pylori infection, and risk of gastric cancer and its precursors in a chinese population.
21949773 2011 Luminal-applied flagellin is internalized by polarized intestinal epithelial cells and elicits immune responses via the TLR5 dependent mechanism.
21721932 2011 The presence of functionally relevant toll-like receptor polymorphisms does not significantly correlate with development or outcome of sepsis.
21714724 2012 Dual oxidase 2 is essential for the toll-like receptor 5-mediated inflammatory response in airway mucosa.
21573018 2011 Induction of TLR-2 and TLR-5 expression by Helicobacter pylori switches cagPAI-dependent signalling leading to the secretion of IL-8 and TNF-?.
21455638 2011 Increased expression of toll-like receptors (TLR) 2, 4 and 5 in gastric dysplasia.
21455558 2011 Flagellin promotes the proliferation of gastric cancer cells via the Toll-like receptor 5.
21237205 2011 All-trans retinoic acid induces TLR-5 expression and cell differentiation and promotes flagellin-mediated cell functions in human THP-1 cells.
21204905 2011 Intimate adherence by enteropathogenic Escherichia coli modulates TLR5 localization and proinflammatory host response in intestinal epithelial cells.
21109746 2011 Flagellin induces the expression of thymic stromal lymphopoietin in human keratinocytes via toll-like receptor 5.
21068401 2010 TLR5 as an anti-inflammatory target and modifier gene in cystic fibrosis.
21067314 2011 Toll like receptor 5 (TLR5) may be involved in the immunological response to Aspergillus fumigatus in vitro.
20977567 2011 Polymorphism in 3'-untranslated region of toll-like receptor 4 gene is associated with protection from hepatitis B virus recurrence after liver transplantation.
20953381 2010 The p110? and p110? isoforms of class I phosphatidylinositol 3-kinase are involved in toll-like receptor 5 signaling in epithelial cells.
20952467 2011 Whole-blood gene expression profiling in ankylosing spondylitis shows upregulation of toll-like receptor 4 and 5.
20855887 2010 TRIF mediates Toll-like receptor 5-induced signaling in intestinal epithelial cells.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20656790 2010 Activation of Toll-like receptor 5 decreases the attachment of human trophoblast cells to endometrial cells in vitro.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20626741 2010 IL1RN VNTR and IL2-330 polymorphic genes are independently associated with chronic immune thrombocytopenia.
20604744 2010 A comprehensive genotype-phenotype interaction of different Toll-like receptor variations in a renal transplant cohort.
20595247 2010 Polymorphisms of innate pattern recognition receptors, response to interferon-beta and development of neutralizing antibodies in multiple sclerosis patients.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20483744 2010 TLR stimulation of prostate tumor cells induces chemokine-mediated recruitment of specific immune cell types.
20463618 2010 Role of polymorphic variants as genetic modulators of infection in neonatal sepsis.
20456615 2010 Activation of TLR2 and TLR5 did not affect tumor progression of an oral squamous cell carcinoma, YD-10B cells.
20452988 2010 TRIF modulates TLR5-dependent responses by inducing proteolytic degradation of TLR5.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20364327 2011 SIGIRR inhibits toll-like receptor 4, 5, 9-mediated immune responses in human airway epithelial cells.
20227302 2010 Polymorphisms in innate immunity genes associated with development of bronchiolitis obliterans after lung transplantation.
20196781 2009 Toll-like receptor triggering in cord blood mesenchymal stem cells.
20194452 2010 Multiplex screening of 22 single-nucleotide polymorphisms in 7 Toll-like receptors: an association study in rheumatoid arthritis.
20164175 2010 Reconstitution of a functional Toll-like receptor 5 binding site in Campylobacter jejuni flagellin.
20154223 2010 Induction of human ?-defensin-2 in pulmonary epithelial cells by Legionella pneumophila: involvement of TLR2 and TLR5, p38 MAPK, JNK, NF-?B, and AP-1.
20130217 2010 The single IgG IL-1-related receptor controls TLR responses in differentiated human intestinal epithelial cells.
20100933 2010 Age-associated decrease in TLR function in primary human dendritic cells predicts influenza vaccine response.
20083854 2009 Decreased Toll-like receptor-5 (TLR-5) expression in the mucosa of ulcerative colitis patients.
20056178 2010 Polymorphisms in innate immunity genes and patients response to dendritic cell-based HIV immuno-treatment.
20016852 2009 Genetic variation of the human urinary tract innate immune response and asymptomatic bacteriuria in women.
19950169 2010 PKC-alpha controls MYD88-dependent TLR/IL-1R signaling and cytokine production in mouse and human dendritic cells.
19924287 2009 The heterogeneous allelic repertoire of human toll-like receptor (TLR) genes.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19912257 2010 A20 is an early responding negative regulator of Toll-like receptor 5 signalling in intestinal epithelial cells during inflammation.
19828626 2009 The lupus susceptibility locus Sle1 breaches peripheral B cell tolerance at the antibody-forming cell and germinal center checkpoints.
19786303 2009 Induction of IL-8 expression by bacterial flagellin is mediated through lipid raft formation and intracellular TLR5 activation in A549 cells.
19758322 2010 Activation of toll-like receptors 2, 3 or 5 induces matrix metalloproteinase-1 and -9 expression with the involvement of MAPKs and NF-kappaB in human epidermal keratinocytes.
19638314 2009 IL2-330G polymorphic allele is associated with decreased risk of Helicobacter pylori infection in adulthood.
19620771 2009 Polyethylenimine-based siRNA nanocomplexes reprogram tumor-associated dendritic cells via TLR5 to elicit therapeutic antitumor immunity.
19616328 2010 Association of single-nucleotide polymorphisms in toll-like receptor 5 gene with rheumatic heart disease in Chinese Han population.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19543401 2009 Toll-like receptor polymorphisms and susceptibility to urinary tract infections in adult women.
19505919 2009 Toll-like receptor signaling pathway variants and prostate cancer mortality.
19473567 Investigation of TLR5 and TLR7 as candidate genes for susceptibility to systemic lupus erythematosus.
19447460 2009 TLR5 stimulation is sufficient to trigger reactivation of latent HIV-1 provirus in T lymphoid cells and activate virus gene expression in central memory CD4+ T cells.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19179655 2009 A history of recurrent positive selection at the toll-like receptor 5 in primates.
19150884 2009 Toll-like receptors 4 and 5 induce distinct types of vasculitis.
19134113 2009 The ex vivo response of human intestinal mucosa to enteropathogenic Escherichia coli infection.
19120490 2009 Systems biology of innate immunity.
19067129 2009 Expression and functional analysis of toll-like receptors of peripheral blood cells in asthmatic patients: implication for immunopathological mechanism in asthma.
18810425 2008 Natural selection in the TLR-related genes in the course of primate evolution.
18809506 Toll-like receptor (TLR2, TLR4 and TLR5) gene polymorphisms and Helicobacter pylori infection in children with and without duodenal ulcer.
18776592 2008 Polymorphisms of toll like receptors in the genetics of severe RSV associated diseases.
18686608 2008 [Expression of toll-like receptors in human epidermal keratinocytes].
18684966 2008 TLR expression on neutrophils at the pulmonary site of infection: TLR1/TLR2-mediated up-regulation of TLR5 expression in cystic fibrosis lung disease.
18680520 2008 TLR 5, but neither TLR2 nor TLR4, is involved in lung epithelial cell response to Burkholderia cenocepacia.
18590761 2009 Porcine Toll-like receptors: the front line of pathogen monitoring and possible implications for disease resistance.
18538140 2008 Toll-like receptor 5 engagement modulates tumor development and growth in a mouse xenograft model of human colon cancer.
18490781 2008 Innate immunity mediated by TLR5 as a novel antiinflammatory target for cystic fibrosis lung disease.
18394314 Toll-like receptors.
18325643 2008 Associations between SNPs in toll-like receptors and related intracellular signaling molecules and immune responses to measles vaccine: preliminary results.
18314303 2008 IL-1beta expression in Int407 is induced by flagellin of Vibrio cholerae through TLR5 mediated pathway.
18213697 2008 Novel NOD2 haplotype strengthens the association between TLR4 Asp299gly and Crohn's disease in an Australian population.
18167552 2008 Microbial patterns signaling via Toll-like receptors 2 and 5 contribute to epithelial repair, growth and survival.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17587322 Increased expression of Toll-like receptor 5 during progression of cervical neoplasia.
17516623 2007 Association study of Toll-like receptor 5 (TLR5) and Toll-like receptor 9 (TLR9) polymorphisms in systemic lupus erythematosus.
17442957 2007 Protein kinase D interaction with TLR5 is required for inflammatory signaling in response to bacterial flagellin.
17283206 2007 A conserved surface on Toll-like receptor 5 recognizes bacterial flagellin.
17157808 2007 A phosphorylation site in the Toll-like receptor 5 TIR domain is required for inflammatory signalling in response to flagellin.
17128265 2006 Maintenance of colonic homeostasis by distinctive apical TLR9 signalling in intestinal epithelial cells.
16971956 2006 Gene polymorphisms in Toll-like receptors, interleukin-10, and interleukin-10 receptor alpha and lymphoma risk.
16897777 2006 Microbial induction of CARD15 expression in intestinal epithelial cells via toll-like receptor 5 triggers an antibacterial response loop.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16670329 2006 TLR5-mediated phosphoinositide 3-kinase activation negatively regulates flagellin-induced proinflammatory gene expression.
16644730 2006 Role of MyD88 in phosphatidylinositol 3-kinase activation by flagellin/toll-like receptor 5 engagement in colonic epithelial cells.
16482509 2006 Binding specificity of Toll-like receptor cytoplasmic domains.
16470719 2006 Characterization and functional investigation of single nucleotide polymorphisms (SNPs) in the human TLR5 gene.
16439468 2006 Dominant-negative TLR5 polymorphism reduces adaptive immune response to flagellin and negatively associates with Crohn's disease.
16339542 2005 Human CD4+ T cells express TLR5 and its ligand flagellin enhances the suppressive capacity and expression of FOXP3 in CD4+CD25+ T regulatory cells.
16284379 2005 The interaction of four genes in the inflammation pathway significantly predicts prostate cancer risk.
16239509 2005 Human airway epithelial cells sense Pseudomonas aeruginosa infection via recognition of flagellin by Toll-like receptor 5.
16179598 2006 Flagellin/TLR5 responses in epithelia reveal intertwined activation of inflammatory and apoptotic pathways.
16044857 2005 Toll-like receptors TLR4, TLR5 and TLR9 on gastric carcinoma cells: an implication for interaction with Helicobacter pylori.
16027372 2005 A stop codon polymorphism of Toll-like receptor 5 is associated with resistance to systemic lupus erythematosus.
16024789 2005 A novel splice variant of interleukin-1 receptor (IL-1R)-associated kinase 1 plays a negative regulatory role in Toll/IL-1R-induced inflammatory signaling.
15956202 2005 Evasion of Toll-like receptor 5 by flagellated bacteria.
15747241 2005 Host susceptibility and clinical outcomes in toll-like receptor 5-deficient patients with typhoid fever in Vietnam.
15731050 2005 Helicobacter pylori induces interleukin-8 secretion by Toll-like receptor 2- and Toll-like receptor 5-dependent and -independent pathways.
15685542 2005 Bacterial CpG induces hyper-IgM production in CD27(+) memory B cells in primary biliary cirrhosis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15302888 2004 In vitro and ex vivo activation of the TLR5 signaling pathway in intestinal epithelial cells by a commensal Escherichia coli strain.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15135456 2004 Polymorphism report: identification of two common single nucleotide polymorphisms in the human toll-like receptor 5 (TLR5) gene.
15107846 2004 Triad3A, an E3 ubiquitin-protein ligase regulating Toll-like receptors.
15069060 2004 MEK is a key modulator for TLR5-induced interleukin-8 and MIP3alpha gene expression in non-transformed human colonic epithelial cells.
15067088 2004 Human intestinal microvascular endothelial cells express Toll-like receptor 5: a binding partner for bacterial flagellin.
14707135 2004 Gangliosides act as co-receptors for Salmonella enteritidis FliC and promote FliC induction of human beta-defensin-2 expression in Caco-2 cells.
14625308 2004 Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.
14623910 2003 A common dominant TLR5 stop codon polymorphism abolishes flagellin signaling and is associated with susceptibility to legionnaires' disease.
14607814 2004 Pseudomonas aeruginosa flagella activate airway epithelial cells through asialoGM1 and toll-like receptor 2 as well as toll-like receptor 5.
12933896 2003 Signaling via Toll-like receptor 5 can initiate inflammatory mediator production by murine osteoblasts.
12925853 2003 SIGIRR, a negative regulator of Toll-like receptor-interleukin 1 receptor signaling.
12794153 2003 Induction of macrophage nitric oxide production by Gram-negative flagellin involves signaling via heteromeric Toll-like receptor 5/Toll-like receptor 4 complexes.
12734364 2003 The Toll-like receptor 5 stimulus bacterial flagellin induces maturation and chemokine production in human dendritic cells.
12702497 2003 TLR5-mediated activation of p38 MAPK regulates epithelial IL-8 expression via posttranscriptional mechanism.
12600829 2003 Associations between toll-like receptors and interleukin-4 in the lungs of patients with tuberculosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12185085 2002 Two nonadjacent regions in enteroaggregative Escherichia coli flagellin are required for activation of toll-like receptor 5.
11953430 2002 Gram-negative flagellin-induced self-tolerance is associated with a block in interleukin-1 receptor-associated kinase release from toll-like receptor 5.
11782555 2002 Toll-like receptors.
11561001 2001 Subsets of human dendritic cell precursors express different toll-like receptors and respond to different microbial antigens.
11323673 2001 The innate immune response to bacterial flagellin is mediated by Toll-like receptor 5.
10820283 2000 Differential expression and regulation of toll-like receptors (TLR) in human leukocytes: selective expression of TLR3 in dendritic cells.
10677315 2000 Genome screening in human systemic lupus erythematosus: results from a second Minnesota cohort and combined analyses of 187 sib-pair families.
10513806 1999 Confirmation of genetic linkage between human systemic lupus erythematosus and chromosome 1q41.
10426995 1999 Host defense mechanisms triggered by microbial lipoproteins through toll-like receptors.
10072432 1999 Genome-wide screen for systemic lupus erythematosus susceptibility genes in multiplex families.
9843983 1998 A genome-wide search for susceptibility genes in human systemic lupus erythematosus sib-pair families.
9843982 1998 Genome scan of human systemic lupus erythematosus: evidence for linkage on chromosome 1q in African-American pedigrees.
9596645 1998 Cloning and characterization of two Toll/Interleukin-1 receptor-like genes TIL3 and TIL4: evidence for a multi-gene receptor family in humans.
9435236 1998 A family of human receptors structurally related to Drosophila Toll.
9045876 1997 Evidence for linkage of a candidate chromosome 1 region to human systemic lupus erythematosus.