Property Summary

NCBI Gene PubMed Count 200
PubMed Score 635.61
PubTator Score 285.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma 1.100 2.0e-02
astrocytoma 1.600 4.0e-02
glioblastoma 1.300 3.5e-02
intraductal papillary-mucinous adenoma (... 1.400 2.5e-02
lung cancer -1.400 3.9e-03
mucosa-associated lymphoid tissue lympho... 1.723 4.7e-02
pancreatic cancer 1.100 4.4e-03
pancreatic carcinoma 1.100 4.4e-03
pituitary cancer -1.300 2.6e-04
subependymal giant cell astrocytoma 1.946 8.8e-03
tuberculosis 1.500 1.8e-02

Protein-protein Interaction (10)

Gene RIF (181)

AA Sequence

MGDHLDLLLGVVLMAGPVFGIPSCSFDGRIAFYRFCNLTQVPQVLNTTERLLLSFNYIRTVTASSFPFLE      1 - 70
QLQLLELGSQYTPLTIDKEAFRNLPNLRILDLGSSKIYFLHPDAFQGLFHLFELRLYFCGLSDAVLKDGY     71 - 140
FRNLKALTRLDLSKNQIRSLYLHPSFGKLNSLKSIDFSSNQIFLVCEHELEPLQGKTLSFFSLAANSLYS    141 - 210
RVSVDWGKCMNPFRNMVLEILDVSGNGWTVDITGNFSNAISKSQAFSLILAHHIMGAGFGFHNIKDPDQN    211 - 280
TFAGLARSSVRHLDLSHGFVFSLNSRVFETLKDLKVLNLAYNKINKIADEAFYGLDNLQVLNLSYNLLGE    281 - 350
LYSSNFYGLPKVAYIDLQKNHIAIIQDQTFKFLEKLQTLDLRDNALTTIHFIPSIPDIFLSGNKLVTLPK    351 - 420
INLTANLIHLSENRLENLDILYFLLRVPHLQILILNQNRFSSCSGDQTPSENPSLEQLFLGENMLQLAWE    421 - 490
TELCWDVFEGLSHLQVLYLNHNYLNSLPPGVFSHLTALRGLSLNSNRLTVLSHNDLPANLEILDISRNQL    491 - 560
LAPNPDVFVSLSVLDITHNKFICECELSTFINWLNHTNVTIAGPPADIYCVYPDSFSGVSLFSLSTEGCD    561 - 630
EEEVLKSLKFSLFIVCTVTLTLFLMTILTVTKFRGFCFICYKTAQRLVFKDHPQGTEPDMYKYDAYLCFS    631 - 700
SKDFTWVQNALLKHLDTQYSDQNRFNLCFEERDFVPGENRIANIQDAIWNSRKIVCLVSRHFLRDGWCLE    701 - 770
AFSYAQGRCLSDLNSALIMVVVGSLSQYQLMKHQSIRGFVQKQQYLRWPEDFQDVGWFLHKLSQQILKKE    771 - 840
KEKKKDNNIPLQTVATIS                                                        841 - 858
//

Text Mined References (203)

PMID Year Title