Property Summary

Ligand Count 20
NCBI Gene PubMed Count 2,039
PubMed Score 6905.76
PubTator Score 3527.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Skin cancer 469 0.0 0.6
Disease Target Count
Behcet's syndrome 50
Contact Dermatitis 81

Expression

  Differential Expression (25)

Disease log2 FC p
lung cancer -1.200 9.8e-04
cystic fibrosis -1.781 2.0e-05
adrenocortical carcinoma -1.555 9.7e-06
astrocytic glioma 1.100 4.0e-02
Astrocytoma, Pilocytic 1.100 5.6e-03
atypical teratoid / rhabdoid tumor -1.100 1.3e-03
fibroadenoma -1.200 1.5e-02
gastric cancer 1.100 3.1e-02
Gaucher disease type 3 -1.900 1.3e-02
glioblastoma 1.700 2.2e-02
group 4 medulloblastoma -1.400 5.8e-05
hepatocellular carcinoma 1.400 4.6e-03
lung adenocarcinoma -1.100 1.5e-07
lung carcinoma -2.400 2.4e-31
malignant mesothelioma -2.800 1.4e-08
medulloblastoma, large-cell -1.300 5.4e-04
non-small cell lung cancer -1.049 8.5e-11
osteosarcoma -1.487 2.3e-02
ovarian cancer -2.100 2.5e-07
pancreatic cancer 1.300 1.6e-02
pancreatic carcinoma 1.300 1.6e-02
pediatric high grade glioma 1.400 5.0e-03
psoriasis -1.500 7.0e-05
Rheumatoid arthritis 1.800 2.5e-02
ulcerative colitis 1.200 6.2e-03

Protein-protein Interaction (2)

PDB (11)

Gene RIF (2178)

AA Sequence

MMSASRLAGTLIPAMAFLSCVRPESWEPCVEVVPNITYQCMELNFYKIPDNLPFSTKNLDLSFNPLRHLG      1 - 70
SYSFFSFPELQVLDLSRCEIQTIEDGAYQSLSHLSTLILTGNPIQSLALGAFSGLSSLQKLVAVETNLAS     71 - 140
LENFPIGHLKTLKELNVAHNLIQSFKLPEYFSNLTNLEHLDLSSNKIQSIYCTDLRVLHQMPLLNLSLDL    141 - 210
SLNPMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGL    211 - 280
CNLTIEEFRLAYLDYYLDDIIDLFNCLTNVSSFSLVSVTIERVKDFSYNFGWQHLELVNCKFGQFPTLKL    281 - 350
KSLKRLTFTSNKGGNAFSEVDLPSLEFLDLSRNGLSFKGCCSQSDFGTTSLKYLDLSFNGVITMSSNFLG    351 - 420
LEQLEHLDFQHSNLKQMSEFSVFLSLRNLIYLDISHTHTRVAFNGIFNGLSSLEVLKMAGNSFQENFLPD    421 - 490
IFTELRNLTFLDLSQCQLEQLSPTAFNSLSSLQVLNMSHNNFFSLDTFPYKCLNSLQVLDYSLNHIMTSK    491 - 560
KQELQHFPSSLAFLNLTQNDFACTCEHQSFLQWIKDQRQLLVEVERMECATPSDKQGMPVLSLNITCQMN    561 - 630
KTIIGVSVLSVLVVSVVAVLVYKFYFHLMLLAGCIKYGRGENIYDAFVIYSSQDEDWVRNELVKNLEEGV    631 - 700
PPFQLCLHYRDFIPGVAIAANIIHEGFHKSRKVIVVVSQHFIQSRWCIFEYEIAQTWQFLSSRAGIIFIV    701 - 770
LQKVEKTLLRQQVELYRLLSRNTYLEWEDSVLGRHIFWRRLRKALLDGKSWNPEGTVGTGCNWQEATSI     771 - 839
//

Text Mined References (2046)

PMID Year Title