Property Summary

NCBI Gene PubMed Count 487
PubMed Score 1147.21
PubTator Score 792.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count
Herpes simplex encephalitis 2 1

Expression

  Differential Expression (24)

Disease log2 FC p
urothelial carcinoma -1.700 4.9e-02
malignant mesothelioma -2.000 2.0e-06
cutaneous lupus erythematosus 1.800 1.9e-03
ependymoma 2.100 1.5e-13
glioblastoma 2.100 7.2e-09
juvenile dermatomyositis 1.581 3.9e-12
non-small cell lung cancer -1.632 1.3e-15
lung cancer -3.300 1.1e-05
colon cancer -2.400 4.5e-03
active Crohn's disease 1.320 1.4e-02
breast carcinoma -1.200 1.3e-04
interstitial cystitis -1.200 2.5e-03
lung adenocarcinoma -1.300 8.4e-10
pediatric high grade glioma 2.200 7.4e-07
pilocytic astrocytoma 2.400 8.2e-10
aldosterone-producing adenoma -1.366 5.6e-03
subependymal giant cell astrocytoma 1.839 4.7e-02
Endometriosis -1.375 3.4e-03
lung carcinoma -2.500 1.8e-23
Breast cancer -1.400 4.5e-05
ductal carcinoma in situ -1.500 4.5e-03
invasive ductal carcinoma -1.900 2.8e-03
ovarian cancer -2.300 2.2e-06
pituitary cancer 1.200 1.6e-02

Gene RIF (467)

PMID Text
26797279 Based on the collective findings, we suggest that vIRF2 acts as an activator in PI3K/Akt pathway.
26646717 Using bone marrow derived macrophages from knockout mice we demonstrate that hBD3 suppresses the polyI:C-induced TLR3 response mediated by TICAM1 (TRIF), while exacerbating the cytoplasmic response through MDA5 (IFIH1) and MAVS (IPS1/CARDIF).
26589477 TLR3 activation increases chemokine expression in human fetal airway smooth muscle cells
26584291 TLR3 polymorphisms are unlikely to play a significant role in the development of preeclampsia in the Chinese Han population.
26536229 High TLR3 expression is associated with Inflammatory Bowel Disease.
26512422 Study found TLR3 and IFNgamma to play an important role in Hepatitis E pathogenesis. Patients expressing high levels of TLR 3 and robust IFNgamma response are able to recover from the disease; while those with lower expression progress to acute liver failure.
26466955 Knockdown of LRRC59 reduced TLR3-, 8-, and 9-mediated, but not TLR4-mediated, signaling.
26418032 Data indicate that interleukin-17 (IL-17A) and toll like receptor 3 (TLR3) activation cooperate to induce proinflammatory responses in the airway epithelium.
26417991 role of TLR3/BAFF axis in IgA class-switch recombination of IgA nephropathy
26367324 The anti-viral effect of IL-24 correlated with caspase-3 activation and could be blocked by a pan-caspase inhibitor and by small interfering RNA (siRNA) directed towards TLR3.
26318769 no association between geneetic variants and the risk for autoimmune destruction of the adrenal cortex and beta cells in Polish patients
26313906 ATX was induced in monocytic THP-1 cells by TLR4 ligand lipopolysaccharide (LPS), TLR9 ligand CpG oligonucleotide, and TLR3 ligand poly(I:C), respectively
26303210 Data suggest that the toll like receptor 3 (TLR3)-interferon regulatory factor 6 protein (IRF6)-interleukin-23 subunit p19 (p19)/EBI3 protein axis may regulate keratinocyte functions in the skin.
26298326 TLR3 gene polymorphism might confer host genetic susceptibility to JE in Indian population. TLR3 polymorphism did not affect the mortality.
26296370 findings demonstrate the potential of BTV-mediated TLR3 activation in macrophage innate immunity against HIV
26255864 mechanism conversely holds for plasmacytoid DCs that respond to TLR3 ligation when TLR7 pathway is mobilized.
26253200 dsRNA and TLR3 link the earliest events of mammalian skin wounding to regeneration and suggest potential therapeutic approaches for promoting hair neogenesis.
26238371 TLR3 and TLR4 But not TLR2 are Involved in Vogt-Koyanagi- Harada Disease by Triggering Proinflammatory Cytokines Production Through Promoting the Production of Mitochondrial Reactive Oxygen Species
26226228 SNP rs3775291 in TLR3 may influence patient outcome in breast cancer
26208481 Findings indicate that melanoma differentiation associated protein-5 (MDA5) may serve as a complementary role in the toll-like receptor3 (TLR3) activated suppression of neuroblastoma (NB).
26172457 TLR3 has a role in inducing inflammation in nasopharyngeal carcinoma through EBV-encoded RNA
26123900 TLR-3 pathway dysfunctions may be closely involved in INS pathogenesis.
26100173 It reacts with double-stranded RNA(dsRNA) and participates in the immune response after viral infection.
26077030 Study clearly demonstrated that the expression of this isoform of TLR3 was a negative regulator of signaling pathways and that it was inducible by type I interferons. Authors also found that this isoform could modulate inflammation in the brain.
26024592 The results indicated that genetic variant in TLR3 gene rs3775290 polymorphisms may be a protective factor for chronic hepatitis B, hepatitis B virus-related liver cirrhosis, and hepatocellular carcinoma in the Chinese population.
25992926 This genetic analysis revealed the absence of an association between the polymorphisms investigated and susceptibility to HBV and HCV infection but might be associated with a greater degree of biliary damage during the course of HCV infection.
25918231 These results increase the understanding of the function of innate receptors in metabolic disorders and implicate TLR3 as a key control system in metabolic regulation.
25912131 Present results propose a putative role of TLRs 3,7, and 9 in the growth process of juvenile nasopharyngeal angiofibroma.
25880109 Thus, signaling through both RIG-I and TLR3 is important for interferon induction by influenza A virus in human lung alveolar epithelial cells.
25867514 demonstrate that TLR-3 is highly expressed in adipocytes and functionally active. However, TLR-3 appears to play a redundant role in obesity-induced inflammation and insulin resistance
25794662 TLR3 stimulates the differentiation of mesenchymal stromal cells from human tonsils into follicular dendritic cell-like cells and induces chemokine secretion, possibly by recruiting C-X-C chemokine receptor 2-expressing immune cells.
25780039 A role for APPL1 in TLR3/4-dependent TBK1 and IKKepsilon activation in macrophages.
25754842 Data show that toll-like receptor 3/TRIF protein signalling regulates cytokines IL-32 and IFN-beta secretion by activation of receptor-interacting protein-1 (RIP-1) and tumour necrosis factor receptor-associated factor 6 (TRAF6) in cornea epithelial cells.
25736436 WDFY1 mediates TLR3/TLR4 signaling by recruiting TRIF.
25720507 TLR3 SNP rs3775291 may affect heart in Japanese patients with sarcoidosis.
25695694 We found that the activation of TLR3 inhibited the differentiation of UCMSCs into osteocytes, while that of TLR4 increased this differentiation to a certain extent.
25689620 Galectin-3 knockdown inhibited TLR-2, -3 and -4-induced IL-6 secretion, but not TLR-2, -3 and -4-mediated matrix metalloproteinase-3 or CC chemokine ligand-5 secretion.
25668563 Alterations in TLR3 expression in white matter were found in the thalamus from extremely premature infants.
25652132 Roflumilast improves corticosteroid resistance COPD bronchial epithelial cells stimulated with toll like receptor 3 agonist.
25641411 Scavenger receptor SREC-I promotes double stranded RNA-mediated TLR3 activation in human monocytes
25605704 activation of TLR 3 in endometrial cells decreases the adhesion of trophoblast cells to endometrial cells in vitro; TLR 3 stimulation leads to alterations in actin polymerization, CD98 and beta3 integrin expression
25594115 findings indicate that functional TLR3 is expressed in CD34(+) cells, megakaryocytes, and platelets, and suggest a potential role for this receptor in the megakaryopoiesis/thrombopoiesis alterations that occur in viral infections
25471749 We found that activation of TLR3 signaling could induce the expression of CXCL1 in mesangial cells
25452586 TLR3 mediated antibody response to Chikungunya virus infection, virus replication and pathology.
25444175 The presence of TLR3 and IRF-3 in both human normal and PCa clinical samples, potentially envisaging poly I:C-based therapy for PCa.
25436985 Inflammatory status in rheumatoid arthritis is associated with an increased expression of TLR3 and of IL-1beta in CD34+ cells, which appear to affect cell number.
25423559 Suggest genetic polymorphisms in TLR3/6 may have a plausible role in the occurrence of severe acute pancreatitis.
25388852 The TLR3 (c.1377C/T) and TLR9 (G2848A) polymorphisms may be relevant for hepatitis B virus (HBV) intrauterine transmission susceptibility, although the reduction in risk to HBV intrauterine transmission is modest.
25373689 our results demonstrate increased risk for cervical cancer associated with homozygous TLR3 (c.1377C>T) C/C genotype, and TLR4 (Asp299Gly) Asp allele and Asp/Asp genotype.
25348355 For the first time, in the present work, we are convincingly reporting the functional evidence that TLR-3 induces cell survivability and metastasis through cell surface.
25339207 Childhood-onset herpes simplex encephalitis is due to TLR3 deficiency in a traceable fraction of patients.
25309919 The expression of TLR-3, -7, and -9 is increased when the macrophages were treated with the supernatant of cervical cancer cells.
25304972 findings support the notion that TLR3 genetic variants may represent a common risk factor in different chronic inflammatory conditions, including RA and SLE
25257174 Stimulation of toll-like receptor 3 (TLR3) promotes breast cancer cells toward a cancer stem cell phenotype in vitro and in vivo.
25226020 The polymorphism of TLR3 gene predisposes to clinical TBE in adults only and may be associated with disease severity.
25217833 TLR3 transmembrane domain in dimeric and trimeric states
25214272 Increased risk of influenza for people with Leu412capital ER, Cyrilliche TLR-3 genotype
25171218 Results indicate that, in our population, the presence of the C allele of -7C/A in TLR3 increases the susceptibility to end-stage renal disease.
25171086 In the absence of TP63, keratinocytes readily presented TSLP and other cytokines by stimuli through Toll-like receptor 3.
25127040 TLR3 expression does not directly affect viral replication or cytotoxicity. Analysis of experimentally validated NFkappaB-responsive genes revealed a West Nile virus-induced signature largely independent of TLR3.
25126563 TLRs 3, 7, and 8 are prime biomarker candidates for HCV infection mRNA expression analysis which might improve current therapeutic approaches.
25121361 TLR 4 along with TLR 3 and 9 is responsible for the antiviral response in HSV infections
25098814 TLR-3 signalling regulates the expression of autoantigens by salivary gland epithelial cells, implicating innate immunity pathways in their over-expression in inflamed tissues and possibly in their exposure to the immune system
25092290 LL-37 peptide enhanced signal transduction by Toll-like receptor 3 is regulated by pH.
25008898 Hepatitis C virus infection decreases the expression of TLR-3 and TLR-7 via upregulation of miR-758.
24934575 Overexpression of TLR3 enhanced the activity of the IFN-beta promoter and the transcription factor NF-kappa B, thereby decreasing viral protein synthesis.
24905199 The Src activation by TLR3 changes cell migration, adhesion, and proliferation rates and how IRF-3 activation by RLR triggers a gene induction-independent pro-apoptotic pathway that provides strong antiviral protection.
24889229 The individual amino acid changes P320S and M333V in West Nile virus NS1 restored TLR3 signaling in virus-infected HeLa cells, however, virus replication was also attenuated.
24886842 mRNA and corresponding protein expression of TLR3, TLR7, TLR9, RIG-I and MDA-5 were analyzed in nasal biopsies and various upper airway epithelial cell lines.
24845156 Patients undergoing PCI were shown to have a TLR-dependent pro-inflammatory state, mediated by a downregulation of TLR3 pathway, and upregulation of TLR4.
24819172 indicates a significant association of four TLR3 gene polymorphisms with cancer risk
24791904 AP1S3 silencing disrupted the endosomal translocation of the innate pattern-recognition receptor TLR-3 (Toll-like receptor 3) and resulted in a marked inhibition of downstream signaling.
24786223 The mechanisms that help repair UV-damaged cells have recently been more clearly defined with the observation that Toll-like receptor 3 can sense self RNA released from necrotic keratinocytes following UV damage.
24768503 Single-SNP analysis showed an association between the exonic SNP (rs3775290) in TLR3 and post-vaccination serogroup C meningococcal IgG concentrations
24766260 c.1377C/T polymorphism not associated with delayed onset of labour in pregnancy
24760149 TLR3 activation augments matrix metalloproteinase production through reactive nitrogen species generation in human lung fibroblasts.
24739633 This study is the first to link TLR3 to activation of the alternative complement pathway.
24719229 No investigated polymorphisms showed any association with systemic lupus erythematosus.
24712925 The results suggest roles for TLR3, TLR10, PLAT (n=2), VEGFA and DENND1B in susceptibility to chronic cavitary pulmonary aspergillosis.
24709775 Regulatory phenotype, PD-1 and TLR3 expression in T cells and monocytes from HCV patients undergoing antiviral therapy
24708416 IL-17 influences the innate immune system in rheumatoid arthritis by increasing the synovial expression of TLR3 via the STAT3 pathway.
24701034 CXCL10 expression is induced by Hantaan virus infection through TLR3, RIG-I, and MDA-5 pathways correlated with the disease severity
24693944 MUC1 has a role in regulating epithelial inflammation and apoptosis by PolyI:C through inhibition of TRIF recruitment to Toll-like receptor 3
24692849 TLR3, 7, and 9 play a role in the pathogenesis of SLE and have an impact on organ involvement in systemic lupus erythematosus
24682730 The results suggest that AMD pathology in North Indian AMD patients is not affected by TLR3 signaling but it could be influenced by other genetic or environmental factors unique to North India.
24672048 Enterovirus 68 3C protease cleaves TRIF to attenuate antiviral responses mediated by TLR3.
24651829 TLR3 receptor and ligand endocytosis as well as endosomal acidification are important for the robust signaling of TLR3.
24651439 RNase L activity limits FFA/obesity-induced impairment of insulin response in muscle cells via TLR3 and MnSOD expression.
24565447 This study found that the mRNA levels of TLR3 and TLR4 are increased in depressed suicide, non-depressed suicide and depressed non-suicide compared with control.
24558379 infection-induced up-regulation of GPR15 expression through TLR3 could increase susceptibility of CD4(+) T cells to HIV infection and target cell availability in the gut in some infected individuals
24535857 The study indicates that the TLR3 gene polymorphism is not associated with polypoidal choroidal vasculopathy and neovascular age-related macular degeneration in northern Chinese patients.
24530528 Disrupting the interaction between mannan binding lectin (MBL) and complement receptor 1 or restraining the traffic of MBL to phagosome reverses the MBL limited TLR3 activation.
24524192 [review] A wide spectrum of TLR3 ligand structures beyond double-stranded RNA and their delivery systems provide new insights into the physiological role of TLR3 in virus- or host-derived RNA-induced immune responses.
24445780 Analysis of the association of TLR3 SNPs with SLE clinical characteristics indicated no significant associations for males.In females, comparison of phenotype-positive cases indicated positive associations of rs3775296 with anemia
24408902 TLR3 rs3775291 and rs13126816 polymorphisms are associated with risk for T1DM. The rs5743313 and rs11721827 polymorphisms are associated with age at diagnosis and poor glycemic control.
24371259 Authors propose that TLR3 signaling does not contribute to the rotavirus-specific antibody response in IgA-sufficient individuals, whereas it is associated with elevated antibody titers in IgA-deficient individuals.
24321786 inhibition of autophagy by chemical or genetic approaches blocked TLR4- or TLR3-induced Lys63 (K63)-linked ubiquitination of TNF receptor-associated factor 6
24286242 Data show that IL-29 enhances Il-6 and Il-8 proinflammatory cytokines production in the synovial fibroblasts from rheumatoid arthritis via upregulation of Toll-like receptors TLR2, 3 and 4.
24198284 An A795P TLR3 mutant enhances NF-kappaB activation, disables IRF3 responses, associates constitutively with TRIF & MyD88, & recruits TRAF6 when activated.
24165198 SORBS2 and TLR3 induce premature senescence in primary human fibroblasts and keratinocytes.
24155891 IL-27 enhances the expression of TRAIL and TLR3 in human melanomas.
24146036 The expression of TLR4 and TLR3 closely correlated with the severity of coronary artery disease as reflected by the number of coronary artery stenoses.
24131248 TLR3 and MDA5 signalling, although not expression, is impaired in asthmatic epithelial cells in response to rhinovirus infection.
24105952 it was shown that TLR3-activated MSCs could improve survival in cecal ligation and puncture (CLP)-induced sepsis, while miR-143 overexpression reduced the effectiveness of this therapy
24084648 The absence of Ecm29 enhanced TLR3 signaling, which was characterized by the increased abundance of the adaptor protein and E3 ubiquitin ligase tumor necrosis factor receptor-associated factor 3
24070541 TLR3 L412F-variant patients with idiopathic pulmonary fibrosis (IPF) had defective cytokine, type I IFN, and fibroproliferative responses. TLR3 L412F was associated with greater risk of mortality and accelerated decline in patients with IPF.
24068346 These results suggest that the activation of TLR2, TLR3, and TLR4 might affect intestinal inflammation.
24028589 Study findings suggest that the TLR3 gene polymorphism, rs5743312, may be considered as a biomarker for OLP susceptibility.
23962581 The TLR3 rs3775291 T allele has a protective effect against HIV infection among highly exposed HIV seronegative Caucasian intravenous drug users.
23948864 Shock wave therapy modulates inflammation via the TLR3 pathway.
23946637 Upregulation of TLR2 and TLR3 may be associated with the pathogenesis of wet age-related macular degeneration.
23908180 A markedly higher expression at the mRNA and protein level of TLR3 was observed in active BD patients as compared with controls.
23845419 TLR3 stimulation in keratinocytes induces a caspase-4 dependent release of pro-IL-1beta, but further processing to active IL-1beta is limited. Furthermore, TLR3 stimulation results in pyroptotic- and apoptotic cell death.
23844087 TLR3-induced placental miR-210 down-regulates the STAT6/interleukin-4 pathway, and this may contribute to the development of preeclampsia.
23796347 TLR3 rs5743312 polymorphism could be considered as potential predictor of worse overall survival in advanced oral cancer, but not independently of nodal status. Haplotypes in TLR3 gene might be associated with poor prognosis in OSCC patients.
23748743 Circulating endothelial progenitor cells from umbilical cord blood expressed TLRs, but only TLR3 inhibited cell proliferation, modified cell cycle entry, impaired in vitro angiogenic properties and induced pro-inflammatory cytokines. production.
23744559 CHB patients have reduced TLR3 expression on PBMCs, independent of age, gender and ALT, and on liver cells. Patients with pegylated-interferon-induced SVR have a more significant restoration of TLR3 expression than those under entecavir.
23723066 Data indicate that TIR domain containing adaptor inducing IFN-beta protein (TRIF), as well as TLR3 activation, enhances Kaposi's sarcoma-associated herpesvirus (KSHV) replication and transcription activator (RTA) protein expression.
23721942 These results indicate that the G allele (within the G/G homozygous genotype) of the TLR3 rs3775291 single nucleotide polymorphism is associated with predisposition to Tick-borne encephalitis in the Russian population.
23717201 MSR1 to be a critical component of a TLR3-mediated pattern recognition receptor response that exerts an antiviral state in both infected and uninfected hepatocytes, thereby limiting the impact of HCV proteins that disrupt IFN signaling in infected cells
23716670 Data show that TLR3 activation by poly I-C induces up-regulation of microRNA-29b, -29c, -148b, and -152 targeting DNA methyltransferases, leading to demethylation and reexpression of the oncosuppressor retinoic acid receptor beta (RARbeta).
23673618 TLR3 is a sensor of extracellular viral/host RNA with stable stem structures derived from infection or inflammation-damaged cells.
23668802 Expression of Toll-like receptor-3 is enhanced in active inflammatory bowel disease and mediates the excessive release of lipocalin 2.
23647955 TLR-3 signalling of LX-2 hepatic stellate cells inhibits HCV replication in hepatocytes. TLR-3 activation induces IFN-lambda and IRF expression.
23548575 This study demonstrates for the first time that neurons and glial cells in human neonatal periventricular white matter express TLR3 during development.
23541683 Results showed that positive TLR3 expression was associated with favorable histology and prognosis in neuroblastoma.
23534905 These findings demonstrate that IL-32 is induced by microbial ligands through TLR-mediated innate signaling pathways, suggesting an important role of corneal epithelium in inflammatory disease.
23497334 Alveolar macrophages of smokers demonstrate reduced protein expression of TLR3 and decreased mRNA for TLR3.
23489702 Liver expression of TLR2, TLR3 and TLR7, which are more involved in the immune-pathogenesis of chronic hepatitis C, was investigated.
23467704 Cell surface expression of TLR3 and TLR9 in colon carcinoma cells plays an important role in cell survival.
23425350 Impaired TLR3 and TLR7/8-mediated cytokine responses may contribute to aggressive HCV recurrence postliver transplantation
23404408 TLR3 +1234C/T polymorphism is associated with HBV-related hepatocellular carcinoma.
23396947 Negative regulation of the IRAK1 kinase TLR3-interferon (IFN)-beta and proinflammatory cytokine response includes roles for IRAK1 and IKKepsilon in limiting the intensity of the TLR3-NF-kappaB-signaling pathway as well as IRAK1-IKKepsilon-TAK1-directed regulatory mechanism.
23369718 Studies indicate that the nucleic acid-sensing toll-like receptors (TLRs), which include TLRs 3, 7, 8 and 9 are completely localized within the endosomal compartments of immune cells and recognize RNA and DNA from pathogens.
23353987 As changes in keratinocyte growth and differentiation follow injury, we hypothesized that TLR3 might trigger some elements of the barrier repair program in keratinocytes.
23290562 it reviews current knowledge concerning TLR3, first focusing on TLR3 and its signaling pathway, then reviewing experimental infections in TLR3-deficient mice, and third describing TLR3-deficient humans.[review]
23269203 MyD88-independent innate immune signaling critically contributes to priming of myelin-reactive T cells and development of spontaneous autoimmune encephalomyelitis in MyD88-deficient TCR3 transgenic mice.
23255358 the proteolytic cleavage of TLR3 appears to fulfill function(s) other than separating the two fragments to generate a functional receptor.
23255072 A single nucleotide polymorphism in the promoter region of TLR-3 is associated with elevated TLR-3 gene expression and susceptibility to knee osteoarthritis in a Chinese Han population.
23245579 TLR3 ligation in human astrocytes induces protracted resistance of the cells to H2O2 toxicity.
23240626 Association between a functional polymorphism in Toll-like receptor 3 and chronic hepatitis C in liver transplant recipients
23220997 Analysis of polymorphisms in TLR3 revealed a significant association of intronic TLR3 polymorphism (rs13126816) with the clearance of HCV and the expression of TLR3.
23179584 TLR3 expression was not associated with prognosis in cutaneous malignant melanoma.
23166319 TLR3 is the important regulator of UNC93B1 that in turn governs the responsiveness of all TLR3 as the important regulator of UNC93B1 that in turn governs the responsiveness of all NAS Toll-like receptors
23151015 There is a close relationship between the presence of TLR3 rs5743313/CT and an increased risk of pneumonia in children infected by the pandemic A/H1N1/2009 influenza virus.
23115281 Kaposi's sarcoma-associated herpesvirus vIRF1 and vIRF2 inhibited increases in both IFN-beta message and protein levels following TLR3 activation.
23103873 impaired TLR3- and UNC-93B-dependent IFN-alpha/beta intrinsic immunity to HSV-1 in the CNS, in neurons and oligodendrocytes in particular, may underlie the pathogenesis of HSV-1 encephalitis in children with TLR3-pathway deficiencies
23076446 These results indicate that TLR3 C1234T polymorphism could be a risk factor for the development of chronic Hepatitis B virus infection, especially the chronic hepatitis B-related acute-on-chronic liver failure.
23056470 TRIM38 may act as a novel negative regulator for TLR3-mediated type I interferon signaling by targeting TRIF for degradation
23056170 Data indicate that RO 90-7501 significantly promoted both TLR3 and RLR ligand-induced IFN-beta gene expression and antiviral response, most likely via selective activation of p38 mitogen-activated protein kinase (MAPK) pathway.
23053995 The mRNA expression of TLR3, CXCR4 and IFNgamma in breast cancer tumor tissues was investigated.
22989785 Data suggest that adrenocortical cells express functional TLR3; stimulation through TLR3 may serve to synergistically enhance production of proinflammatory chemokine CXCL10 in such cells.
22960172 These data suggest that human pulmonary artery smooth muscle cells express significant levels of viral TLR3 and respond to its activation by releasing endothelin-1
22950839 TNFA significantly enhanced the TLR3-dependent induction of MMP-9 in human mesangial cells.
22948160 TRIM56 is an essential component of the TLR3 antiviral signaling pathway and reveal a novel role for TRIM56 in innate antiviral immunity.
22944378 The expression of TLR3 in decidual natural killer cells is abnormally higher in unexplained recurrent spontaneous miscarriage patients.
22912896 Data suggest that multiplicative interactions of HLA-A and TLR3 gene might be required for the onset of Stevens-Johnson syndrome (SJS)/toxic epidermal necrolysis (TEN) with ocular complications.
22865861 Inhibition of TLR3 cleavage by either treatment with cathepsin inhibitor or by a mutation in Loop1 decreased the abundance of TLR3 in endosomes targeted for lysosomal degradation.
22864531 A TLR3-mediated upregulation of VEGF and its receptor subtype 2 (VEGF-R2) in human mesangial cells upon activation of viral receptors, is reported.
22851595 TBK1 is essential for the TLR3- and IFN-dependent control of HSV-1 in the central nervous system
22849850 data demonstrated that 25-HC augments the release of IL-8 and IL-6 via NF-kappaB signalling pathway and enhances the release of IL-8 and IFN-beta after stimulation of TLR3 in airway epithelial cells.
22825813 Genetic variations in the TLR3 gene could affect the outcome of hepatitis B virus infection among Saudis.
22771581 These data clearly indicated that retroviral infection exemplified by xenotropic murine leukemia virus-relamoted virus activates the TLR3 signal in human cells.
22762377 these analyses revealed that although IL-8 and MCP-1 gene inductions depended on TLR3 the downstream signalling pathways were distinct.
22759966 TLR3 inhibits SERT activity, which may increase 5-HT extracellular levels and contribute to the inflammatory response
22745793 The results demonstrate that SOCS1 and SOCS3 each play a functionally distinct role in modulating TLR3, JAK/STAT, and CXCR4/CXCR7 signaling in hMSC.
22685032 CXCL10 and CXCR3 were upregulated in colonic mucosa in active inflammatory bowel disease (IBD). The TLR3-ligand poly(I:C) increased release of CXCL10 in colonic epithelial cell lines, suggesting a TLR3-mediated CXCL10 release in IBD patients.
22611194 Cleavage of Toll-like receptor 3 by cathepsins B and H is essential for signaling.
22591330 These data suggest that cigarette smoke augments the expression and responses of TLR3 in human macrophages, and this may contribute to neutrophilic airway inflammation and parenchymal destruction in the lungs of smokers and patients with COPD.
22590509 Triggering of the dsRNA sensors TLR3, MDA5, and RIG-I induces CD55 expression in synovial fibroblasts.
22579623 Toll-like receptor 3 (TLR3) recognizes dsRNA and initiates an innate immune response through the formation of a signaling unit (SU) composed of one double-stranded RNA (dsRNA) and two TLR3 molecules.
22572822 there is a potential therapeutic value of the TLR3 activator poly(I:C) for wound healing
22568929 Data show that Toll-like receptor 3 TLR3 is highly expressed in oral squamous carcinoma cells and oral squamous carcinoma tissues.
22552940 The frequency of four single-nucleotide polymorphisms (SNPs) in the TLR3 gene in 239 patients with genital HSV-2 infection and 162 healthy controls, as well as the impact of these variants on TLR3 gene-expression levels, were compared.
22549436 Evaluated the association between the TLR3 L412F polymorphism in young infants with bronchiolitis. Found TLR3 L412F gene polymorphism including the minor allele T was overrepresented (52%) in infants hospitalized with bronchiolitis.
22537752 TLR3 L412F genetic polymorphism was found to reduce NK cell TLR3-responsiveness and is associated with susceptibility to recurrent herpes labialis.
22504413 Measles-specific expression, cytokine responses and antibody responses were not associated with TLR3 polymorphisms.
22479513 analysis of a novel role for tyrosine phosphorylation in regulating the interaction with IRF3 and the activity of TRIM21 downstream of TLR3 and TLR4
22466005 mediates immune regulatory functions of human mesangial cells in glomerulonephritis
22457005 TLR3 induces the apoptotic cell death of salivary gland epithelial cells (SGECs) via the PI3K-Akt signaling pathway.
22429150 An inflammatory environment and/or Toll-like receptor (TLR) ligation could affect the mesenchymal stromal cell differentiation potential.
22421964 dsRNA induces apoptosis through an atypical death complex associating TLR3 to caspase-8.
22421267 epistatic interaction with prostaglandin E receptor 3 gene confers an increased risk for Stevens-Johnson syndrome with severe ocular surface complications
22415225 Data show that calreticulin and profilin-1 are differentially expressed after poly(I:C) treatment, and that calreticulin expression might be Toll-like receptor 3 (TLR3) dependent by using TLR3 small interfering RNA.
22323545 The results presented in this article clearly identified a new branch of TLR3 signaling
22310660 E2F1 suppresses TLR3 transcription, but during immune stimulation, Rb is upregulated to block the inhibitory effect of E2F1 on TLR3, highlighting a role of Rb-E2F1 axis in the innate immune response in epithelial cells
22260507 human TLR3 is not activated by siRNA, which may be the result of differences in the amino acid composition of the TLR3 loop 1 of mice and humans
22205660 These results suggest that genetic polymorphisms in the TLR3 and CD44 genes are associated with the persistence of the immune response to serogroup C meningococcal vaccines 1 to 6 years after vaccination.
22205631 TICAM1 down-regulation was found to be dependent on TLR3 but not RIG1, MDA5, or PKR and appeared to be regulated post-translationally
22200507 TLR3 induces signaling mechanisms involving TRIF, p38 MAPK and MK2 to enhance stabilization of IFN-beta mRNA contributing to enhanced IFN-beta levels during pathogen infections.
22174453 A common TLR3 allele confers immunologically mediated protection from HIV-1.
22147891 Data indicate that TLR3 promotes CD8+ T-cell memory responses to Aspergillus fumigatus or fungal antigens; loss-of-function SNP in TLR3 may result in ineffective activation of lymphocytes by dendritic cells of hematopoietic transplant patients.
22102050 describe the approach that led to the successful crystallization of the TLR3+3Fab complex
22070917 report provides a novel mechanism for tumor invasion and the TLR3-dependent inflammatory response that could have therapeutic implications for oral squamous cell carcinoma
22065573 Nuclear factor kappaB subunits RelB and cRel negatively regulate Toll-like receptor 3-mediated beta-interferon production via induction of transcriptional repressor protein YY1.
22057682 Endogenous IFN-gamma participates in Toll-like receptor (Tlr)3-mediated antiviral activity, which may have important implications in host cell innate immunity against HSV-1 infection in the central nervous system.
22039520 LL37 and several cell-penetrating peptides can enhance signaling by TLR3 and enable TLR3 to respond to viral dsRNA
22038398 Poly(I:C) significantly reduced the viability of LNCaP cells TLR3 and endosome dependently.
22030901 Activation of chemokine and inflammatory cytokine response in hepatitis C virus-infected hepatocytes depends on Toll-like receptor 3 sensing of hepatitis C virus double-stranded RNA intermediates.
22024499 We have shown here aberrant biological responses mediated by the TLR3 variant receptor, L412F, which may explain in part susceptibility of patients to chronic candidiasis, viral infections and autoimmunity.
22016778 several viral RNA-binding proteins can enhance the dsRNA-dependent innate immune response initiated by TLR3
21998457 The Toll-like receptor (TLR)3/TICAM-1 pathway governs type I interferon induction and protection against poliovirus (PV)infection in PV receptor-bearing transgenic mice.
21990957 Data suggest that TLR3, TLR4, TLR7 and TLR9 expression is important to the biological pathogenesis of esophageal squamous cell carcinoma.
21978158 Lyn kinase blockage down-regulates TLR9-induced cytokines, but up-regulates non-canonical TLR3-induced cytokines in THP1 cells exposed to cytomegalovirus.
21960283 TLR2 and TLR3 expression on cultured esophageal epithelial cells differs from TLR2 and TLR3 expression in esophageal biopsies, which is limited to immune cells during esophagitis.
21952237 ligation of TLR-3 by poly(I:C) induces IDO expression in human first-trimester trophoblasts via an IFN-beta-dependent pathway
21949112 Suggest that Gnia2 is involved in endothelial TLR pathways along a signaling cascade that is distinct from MyD88.
21931545 Hepatitis A virus inhibits TLR3 signaling by reducing abundance of the adaptor protein TRIF.
21911973 Promoter region polymorphism & expression profile of toll like receptor-3 (TLR-3) gene in chronic hepatitis C virus (HCV) patients from India
21911501 Toll-like receptor 3 (TLR3) signaling requires TLR4 Interactor with leucine-rich REPeats (TRIL)
21911422 Results identify a new genetic etiology for childhood herpes simplex encephalitis, indicating that TLR3-mediated immunity is essential for protective immunity to HSV-1 in the central nervous system (CNS) during primary infection in childhood.
21847628 IL-29-induced TLR3 expression is involved in antiviral activity of IL-29 in KCs, which suggests a feasible method to cure certain viral infections of the skin
21844166 TLR7/9 versus TLR3/MDA5 signaling during virus infections and diabetes.
21843566 TLR-2, TLR-3, TLR-4 and TLR-9 were expressed in normal and preeclamptic placentas, in the trophoblast, at the vascular endothelium, and at placental villous stroma, although increased expression was detected in preeclampsia
21839239 Identify TLR3 L412F polymorphism as a novel immunologic marker that could be useful to identify a subpopulation of patients with a lower risk of rejection after liver transplantation for HCV-related cirrhosis.
21829730 study presented the first evidence to show that activation of TLR3 is effective in blocking DENV2 replication via IFN-beta
21802664 Synergy between TLR3 and IL-18 promotes IFN-gamma dependent TRAIL expression in liver NK cells.
21735101 TLR3 has a dual role in pharynx metastatic cell line: on one hand TLR3 activation drove cells to apoptosis while on the other it contributed to tumor progression by altering the expression of tumor promoting genes and enhancing the cell migration.
21730023 analysis of the area under receiver operating characteristic curves showed that ULBP2 was superior to CA 19-9 in discriminating patients with early-stage PC from healthy controls
21722947 Herpes simplex encephalitis may occur in patients carrying NF-kappaB essential modulator mutations, due to the impairment of NF-kappaB- and interferon regulatory factor 3-dependent-TLR3-mediated antiviral IFN production.
21712495 A meta-analysis evaluating the association of the T allele of the TLR3 C1234T variant with the risk of geograhic atrophy is presented.
21708001 TLR3 upregulation of synovial fibroblasts activated by T cells results in articular inflammation.
21695056 PLIC-1 is a novel inhibitor of the TLR3-Trif antiviral pathway by reducing the abundance of Trif
21691053 dsRNA or RV16, induces overproduction of TSLP in COPD-BEC. dsRNA- and RV-induced overproduction of TNF-alpha and CXCL8 involves endosomal TLR3 and cytosolic RIG-I-like helicases
21646299 TLR3-mediated recognition is crucial for polyinosinic-polycytidylic (poly-IC) acid-induced apoptosis in primary human bronchial epithelial cell apoptosis.
21623661 toll-like receptor 3 expression is upregulated in hepatitis C virus-positive patients with glomerulonephritis
21563279 Toll-like receptor-3-activated human mesenchymal stromal cells significantly prolong the survival and function of neutrophils
21515789 Data show that that TLRs 3, 7, and 9 are expressed by human dorsal root ganglion neurons (DRGNs) and in cultures of primary mouse DRGNs.
21498625 The LPS induces TLR3 expression via a TLR4-MyD88-IRAK-TRAF6-NF-kappaB-dependent signaling pathway.
21481769 Studies indicate that TLR3 recognizes dsRNA, which is produced by most viruses at some stage in their life cycles and is a potent indicator of viral infection.
21474651 Our results demonstrate that human esophageal epithelial cells can sense endogenous danger signals, in part through TLR3 signaling.
21454254 In hepatitis C virus-associated glomerulonephritis a significant upregulation of both interferon-gamma-inducible protein and TNF-alpha is mediated specifically by the viral receptor Toll-like receptor 3
21398612 Data show that midazoquinolines, which are TLR7/8 agonists, inhibit TLR9 and TLR3 even in the absence of TLR7 or TLR8, and their mechanism of inhibition is similar to the antimalarials.
21367858 TAp63alpha is a crucial regulator downstream of TLR3 to induce cell death via death receptors -4,-5 and mitochondria.
21266579 Raftlin cooperates with the uptake receptor to mediate cell entry of poly(I:C), which is critical for activation of TLR3.
21255094 Reduced filaggrin levels may influence innate immune responses via TLR stimuli and may contribute to the pathogenesis of inflammatory skin disease via TSLP expression.
21245912 Collectively, these data demonstrate that the intracellular RNA virus sensors (RIG-I, MDA5 and TLR3) are activated upon dengue virus infection and are essential for host defense against the virus.
21239167 TLR-3 polymorphism is an independent prognostic marker for stage II colorectal cancer
21223583 we have demonstrated that IFNalpha2, a type I interferon, increases the expression of TLR3 on human dermal fibroblasts
21220319 Unexpected protective role for Toll-like receptor 3 in the arterial wall.
21216866 A functional TLR3 is a risk factor for tick-borne encephalitis virus infection.
21189260 central role for TAPE (CC2D1A/Freud-1/Aki-1)in linking TLR3 and TLR4 to innate immune defenses at an early step
21179282 targeting the TLR3 pathway may be a promising approach to preventing pathologic angiogenesis in rheumatoid arthritis.
21173679 TLR3 deficiency was reported in 2 children with severe HSV-1 infection.
21148036 TLR3 induces soluble tumor necrosis factor receptor 1 (TNFR1) shedding via signaling from human airway epithelial cells (NCI-H292) with subsequent activation of two downstream pathways.
21132533 This study suggests only marginal role of TLR 3 and 9 gene polymorphisms in cervical cancer susceptibility in North India.
21129170 The expression levels of TLR3, TLR4 and TLR9 have clinical interest as indicators of tumor aggressiveness in breast cancer.
21093032 The L412F variant of Toll-like receptor 3 (TLR3) is associated with cutaneous candidiasis, increased susceptibility to cytomegalovirus, and autoimmunity.
21079408 This study indicates that the TLR3 rs3775291 gene polymorphism is not associated with choroid neovascularization and polypoidal choroidal vasculopathy in Singaporean Chinese patients.
21079408 Observational study of gene-disease association. (HuGE Navigator)
21061265 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20978888 The Samples of carcinomas with recurrence exhibited a significant increase in the mRNA levels of TLR3.
20977567 Observational study of gene-disease association. (HuGE Navigator)
20957750 TLR3-mediated IFN-beta gene induction is negatively regulated by the TLR adaptor MyD88 adaptor-like
20855885 single nucleotide polymorphisms in TLR3 is associated with defective secretion that affected herpesvirus and influenza virus encephalopathy.
20832341 TLR3-mediated immunity against primary infection by Herpes Simplex Virus 1 in the central nervous system is critically dependent on TRAF3.
20819670 The concentrations of TLR1, TLR3, TLR4, TLR7 and TLR9 appeared to be increased in bacterial pleural effusion compared to non-bacterial pleural effusions.
20691286 TLR3 regulates mitochndrial function in cultured human hepatocytes.
20685081 higher constitutive surface expression by salivary epithelial cells from Sjogren's syndrome patients
20673868 Observational study of gene-disease association. (HuGE Navigator)
20651983 Differences in the basal level of HIF-1alpha expression in different prostate cancer cell lines underlie their differential response to TLR3 activation, suggesting a correlation between hypoxic gene expression and tumor responsiveness to TLR agonists.
20639488 Data show the requirement of cotriggering TLR3 and Rig-I on mDCs and RLRs on NK cells for a pathogen product to induce potent innate cell activation.
20636339 TLR3 acativation by polyI:C resulted in inhibition of HIV infections in macrophages via induction of antiviral factors.
20604744 Observational study of gene-disease association. (HuGE Navigator)
20595247 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20588308 Observational study of gene-disease association. (HuGE Navigator)
20523058 Cross-talk between TLR3 signaling and cytokines regulates the expression of CCL5 in airway epithelial cells. TNF-alpha activates NF-kappaB, in cooperation with TLR3 signaling. IFN-gamma stabilizes CCL5 mRNA up-regulated by TLR3, dependent on STAT-1.
20514466 Proapoptosis activity of TLR3 expressed by head and neck squamous cell carcinomas.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20483774 stathmin may fulfill previously unsuspected regulatory roles during inflammation and repair in the adult CNS
20483744 these data show for the first time that TLR3 and TLR5 stimulation of human prostate cancer cells triggers the production of chemokines
20483009 No evidence is found for the association of TLR3 and a single base-pair variation C1236T by genotype, in Australian subjects with multiple sclerosis.
20483009 Observational study of gene-disease association. (HuGE Navigator)
20472559 TLR3 in patients diagnosed with enteroviral myocarditis/cardiomyopathy
20472559 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20422193 No significant differences are found in the TLR3 and TLR10 genotypes or allele distribution between rheumatoid arthritis patients and control individuals.
20422193 Observational study of gene-disease association. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20406303 when TLR3 was stimulated with its specific ligand, the double-stranded RNA poly(I:C), DC-SIGN expression on breast milk macrophages was reduced even in the IL-4-mediated enhanced state.
20381870 Observational study of gene-disease association. (HuGE Navigator)
20367642 Anticancer drugs increase TLR3 expression and subsequently potentiate poly I:C-induced apoptosis
20331378 Observational study of gene-disease association. (HuGE Navigator)
20309865 Our findings indicate that TLR-3 and TLR-7 are expressed in inflammatory myopathic tissues, particularly in immature myoblast precursors.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20227302 Observational study of gene-disease association. (HuGE Navigator)
20200155 TRIS was associated with TRIF upon TLR3 activation by poly(I-C). These findings reveal an unexpected mechanism of TLR3-mediated signaling.
20197609 TLR3c.1377 and TLR9 2848 polymorphisms might be related to multiple sclerosis in Han people in south China.
20197609 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20194452 Observational study of gene-disease association. (HuGE Navigator)
20124101 Data show that TLR activation was associated with significantly increased production of IL-1beta, IL-6, TNF-alpha, and CCL3.
20100933 Studies show substantial decreases in older compared with young individuals in cytokine production in response to TLR1/2, TLR6, TLR3, TLR5, and TLR8, TLR7 and TLR9 in DCs.
20047764 The binding of TRAF2 and TRAF6 to TICAM-1 cooperatively activates the IFN-inducing pathway through ubiquitination of TICAM-1.
20009359 Toll-like receptor (TLR) 3 was detected in 84.7+/- 7.0 % of T cells and 62.7+/- 32.3 % of macrophages (mean+/- SD) in all three patients with fulminant type 1 diabetes.
19966777 To our knowledge, these findings show for the first time that the skin epithelium requires TLR3 for normal inflammation after wounding and that the microflora can modulate specific cutaneous inflammatory responses
19966137 TLR3 pathway is dependent on ELMOD2
19951172 The early HCMV-triggered immune response of human monocyte-derived dendritic cells appears to be independent of TLR3 signaling.
19948350 Dominant negative RIG-I and TRIF supported a model whereby TLR3 activation upregulates RIG-I expression and in turn hypersensitizes cells to RIG-I-mediated cytokine secretion upon simian virus 5 infection.
19914718 These findings reveal a novel mechanistic insight into an interrelationship between SR-A1 and TLR-3/-9 signaling in human cytomegalovirus-exposed monocytes.
19902255 Data show significant associations between SNPs in RARA, RARB, TOP2B and RARG, RXRA, TLR3, TRIM5 and RIG-I genes and rubella virus-specific cytokine immune responses.
19902255 Observational study of gene-disease association. (HuGE Navigator)
19890046 TLR3 and MDA5, but not RIG-I, are required for maximal sensing of rhinovirus dsRNA and that TLR3 and MDA5 signal through a common downstream signaling intermediate, IRF3.
19887600 TLR3 or TLR7 ligand stimulation of tumor cells enhances the cytotoxic activity of expanded gammadelta T cells of cancer patients in vitro.
19878930 Results indicate that TLR3 is a key component in the response of human bronchial epithelial cells to NTHi, and suggest that cognate neutralizing mAbs might be a useful therapeutic tool to regulate the inflammatory response.
19855253 Observational study of gene-disease association. (HuGE Navigator)
19833099 TLR3/IFN-beta expression in monocyte-derived dendritic cells can be used a diagnostic marker of liver damage in acute-on-chronic hepatitis B liver failure.
19810822 Observational study of gene-disease association. (HuGE Navigator)
19795416 Knockdown of BS69 resulted in a decrease of IFN-beta induction, suggesting that BS69 is a positive regulator for the TLR3-TICAM-1 pathway and negative regulatory properties in NF-kappaB activation.
19779021 TLR3 is highly functional in the human esophageal epithelium and TLR3-mediated NF-kappaB signaling may play an important regulatory role in esophageal epithelial homeostasis.
19769802 rhinovirus-induced expression is enhanced by cigarette smoke extract
19758322 Activation of TLR2, TLR3 or TLR5 induces the expression of MMP-1 and MMP-9 in human epidermal keratinocytes.
19752565 The decreased TLR3 expression in eosinophils during symptomatic allergic rhinitis and in the presence of Th2 cytokines indicates a role in allergic airway inflammation.
19748983 Direct activation of interleukin (IL)17A and IL-21 through TLR3 can induce the release of proinflammatory cytokines from CD4-positive T cells.
19741468 TLR4/CD14 and TLR3 polymorphisms have roles in acute rejection after kidney transplantation
19741468 Observational study of gene-disease association. (HuGE Navigator)
19740627 Cultured human melanocytes express functional toll-like receptors 2-4, 7 and 9.
19656899 These data demonstrate, for the first time, that a DNA viral vector, Baculovirus, can activate the TLR3 pathway in human mesenchymal stem cells (hMSCs) and lead to a cytokine expression profile distinct from that in immune cells.
19646728 Triggering TLR3 or TLR4 by poly I:C or LPS induced strong anti-HIV activity in microglia.
19631980 study concludes that trophoblast cells respond to TLR3 ligation by signaling through both NF-kappaB and IRF pathways resulting in expression of inflammatory mediators and, in particular, the preeclampsia-related anti-angiogenic factor sFLT-1
19628747 Results did not confirm the reported associations of TLR3 rs3775291 and TLR4 rs4986790 with age-related macular degeneration (AMD) in the three independent samples, individually or combined.
19628747 Observational study of gene-disease association. (HuGE Navigator)
19625408 Toll-like receptor 3 mediates establishment of an antiviral state against hepatitis C virus in hepatoma cells
19597128 Oxidative stress augments the response of TLR3 in airway epithelial cells to double-stranded RNA via NF-kappaB and that this effect might be partly mediated by the enhancement of TLR3 expression.
19542247 Transduction at the TLR3 initiated by dsRNA stimulates downstream innate immune responses.
19527514 Observational study of gene-disease association. (HuGE Navigator)
19522763 certain tumour cell lines express TLR3 on mRNA and protein level but it is only functional in Detroit 562 cell line
19505919 Observational study of gene-disease association. (HuGE Navigator)
19494321 IFN priming combined with TLR activation may increase immune responses induced by Ag-presenting mesenchymal stromal cell
19475618 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19437550 Activation of TLR3 by double-stranded RNA (poly-I:C) or single-stranded RNA induced IFN-alpha/beta expression. Such activation done prior to HSV-1 infection reduced the susceptibility of the neuronal cells to infection.
19423540 Observational study of gene-disease association. (HuGE Navigator)
19378782 plays a role in innate and adaptive immune responses. (review)
19362356 TLR3 positively regulates late-phase reaction of experimental allergic conjunctivitis, which caused reduced eosinophilic conjunctival inflammation in TLR3KO mice and pronounced it in TLR3Tg mice.
19299748 TLR3 ligand induces NF-kappaB pathway activation in multiple myeloma and support a switching function of type I IFN in the functional outcome of TLR3 triggering in tumor cells.
19265130 TLR2 and TLR3 signaling leads to ras homolog gene family member A (RhoA) activity at distinct cellular compartments.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19254290 Observational study of gene-disease association. (HuGE Navigator)
19247444 Study shows that TLR3 is a major molecule involved in the spatial arrangement of Rabies virus-induced Negri Bodies and viral replication.
19234180 TLR3 is required for pathogenic Hantaan virus-induced expression of the interferon-stimulated MxA and ISG15 genes, but not for MxA induction triggered by the Prospect Hill hantavirus.
19231996 restricted expression of the IFNAR in the differentiated airway epithelium presents a potential mechanism of regulating type I interferon-induced TLR3 expression
19164128 TLR3, TLR4, and TLR8 ligands induce synergistic multiple signaling pathways leading to cytokine mRNA expression and protein production in human monocyte-derived macrophages and dendritic cells
19134117 TLR3 actively participates in the recognition of innate pro-inflammatory response at the early Dengue virus infection DENV stage and leads to the consequent antiviral cytokine/interferons induction in vitro
19120481 Individuals with congenital mutations develop severe HSV-1 encephalitis
19055649 These results suggest that through DC activation, human TSLP and TLR3 ligands promote differentiation of Th17 cells with the central memory T cell phenotype under Th2-polarizing conditions.
19035519 high expression of TLRs 3 and 4, at an early stage of rheumatoid arthritis and the reactivity of synovial fibroblasts in vitro suggest that TLR signaling pathways resulting in inflammation and joint destruction are activated early in the disease process
19019335 Observational study of gene-disease association. (HuGE Navigator)
19016379 Toll-lile receptor 3 gene may confer host genetic susceptibility to subacute sclerosing panencephalitis in Japanese individuals.
19016379 Observational study of gene-disease association. (HuGE Navigator)
19001446 Toll-like receptors 3 highly expressed on human melanoma cells.
18988918 activation of TLR3 can affect the differentiation to myofibroblasts and enhance ECM production via the NF-kappaB-TGF-beta(1)-dependent pathway
18978302 The novel coupling of antiviral defense machinery (i.e., TLR3) and major epithelial proliferation/repair pathway (i.e., EGFR) might play an important role in viral-induced airway remodeling and airway disease exacerbation.
18949355 Results indicate that TLR3 expression in hepatocellular carcinoma plays an important role with regard to cell survival and proapoptotic activity.
18946062 Observational study of gene-disease association. (HuGE Navigator)
18849495 TLR3 has a major role in the development of ARDS-like pathology in the absence of a viral pathogen.
18832709 dsRNA is recognized by differently categorized receptors, cytoplasmic RIG-I-like receptor, membrane-bound TLR3 and cell-surface RNA capture. The endocytic pathway is critical for dsRNA-induced TLR3-mediated cell activation.
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18813073 Observational study of gene-disease association. (HuGE Navigator)
18779317 These results suggest that p53 influences TLR3 expression and function and highlight a role of p53 in innate immune response in epithelial cells.
18776592 Observational study of gene-disease association. (HuGE Navigator)
18776324 Results demonstrate that TLR3 signaling is initiated from the endosome through a pH-dependent binding mechanism, and that a second dsRNA binding site exists in the N-terminal region of the TLR3.
18775079 Our data suggest an involvement of TLR3 and TLR4 in endometrial diseases as demonstrated by altered expression levels in endometriosis and endometrial cancer.
18753640 The TLR3 412Phe variant confers protection against geographic atrophy in macular degeneration.
18753640 Observational study of gene-disease association. (HuGE Navigator)
18725521 caspase-8 has a role in the production of biologically active IL-1beta in response to TLR3 and TLR4 stimulation
18715647 TLR3 expression in newborn dendritic cells exhibits heterocellularity and allelic imbalance (skewing), features characteristic of cis-acting epigenetic control.
18686608 Human epidermal keratinocytes constitutively express all TLR 1-10 mRNA, which may enable human keratinocytes to respond to a wide range of pathogenic micro-organisms.
18684960 TLR3 double-stranded DNA sensing receptor is a dominant stimulator of antiviral pattern recognition molecules and NF-kappaB-induced gene activation in human keratinocytes.
18568036 There are different arrangements of TLR3 ectodomains along the double-stranded RNA that could modulate the strength of the interferon response.
18566393 viral dsRNA may initiate frontline IgG and IgA responses through an innate TLR3-dependent pathway involving BAFF
18566014 Prostate cancer cell lines express TLR3 and the TLR3 agonist poly (I:C) activates mitogen-activated protein kinases and induces inhibition of proliferation as well as caspase-dependent apoptosis.
18562533 West Nile virus nonstructural protein 1 inhibits TLR3 signal transduction.
18544529 Novel model for the formation of TLR3 ectodomain dimers complexed with double strnded RNA, which incorporates this second binding site.
18541719 microfilariae interfere with monocyte-derived DC function by altering TLR3 and TLR4 expression and interfering with both MyD88-dependent signaling and a pathway that ultimately diminishes NF-kappaB activity
18508883 Binding of the glycosylated West Nile virus envelope protein DC-SIGN leads to a reduction in the expression of Toll-like receptor 3 (TLR3) in macrophages from young donors via the signal transducer and activator of transcription 1-mediated pathway.
18442983 cytomegalovirus M45 protein provides a direct cell type-dependent replication benefit to the virus while modulating other biological processes signaling via the RIP1 adaptor such as activation of Toll-like receptor (TLR)3 and other mediators of cell death
18437017 TLR3 and 9 as well as IFN-beta and TNF-alpha are expressed in verruca and molluscum contagiosum skin lesions and may play a pivotal role in cutaneous innate immune responses
18385087 TLR variants are unlikely to have a major impact on overall AMD risk, and the common variants studied were not associated with AMD.
18385087 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18367536 Small interfering RNAs directed against TLR3 greatly reduced the ability of Kaposi's sarcoma-associated herpesvirus to upregulate IFN-beta1 and CXCL10 upon infection
18325643 Observational study of gene-disease association. (HuGE Navigator)
18262679 we summarize the current knowledge on TLR3 and discuss its possible role in innate and adaptive immunity--REVIEW
18253710 Data report that dendritic cell stimulation through the Toll-like receptor 3 ligand dsRNA [poly(I:C)] limits CD4 T-cell proliferation, curtailing adaptive immune responses.
18204787 These data suggest that TLR3 contributes to the malignant phenotype leading to invasive carcinoma in head and neck squamous cell carcinoma.
18172197 TLR3 assembles on dsRNA as stable dimers and the minimal signaling unit is one TLR3 dimer
18029758 Mutagenesis approach showed that conserved histidine residues were essential for the ligand-dependent activation of TLR3.
18021446 Our results show that PAMP receptors, TLR3, TLR7 and RIG-I mRNA levels are significantly down-regulated in patients with chronic hepatitis C infection when compared with healthy controls.
17982077 the spatiotemporal mobilization of TICAM-1 in response to dsRNA and the formation of the TICAM-1 speckles containing RIP1 and NAP1 are important for the activation of the TLR3-TICAM-1 pathway.
17964520 Observational study of genotype prevalence. (HuGE Navigator)
17963596 Abnormal expression of TLR3 and CD86 may relate to the persistence of HBV infection.
17962701 TLR3 expression on mesenchymal stem cells (MSCs) may provide an effective mechanism to block the immunosuppressive activity of MSCs and therefore to restore an efficient T-cell response in the course of dangerous infections
17962643 findings show that NK cells display heterogeneous levels of TLR3 mRNA transcript; clones displaying higher TLR3 mRNA transcripts were characterized by higher cytokine production and cytotoxicity
17947455 Our data suggest that the intestinal microvasculature is responsive to ligands of TLR3 expressed on intestinal endothelial cells, thereby adding to the regulation of adaptive immunity and leukocyte recruitment.
17939877 Observational study of gene-disease association. (HuGE Navigator)
17939877 TLR3 polymorphisms may be relevant to nasopharyngeal carcinoma susceptibility in the Cantonese population.
17908959 TLR3 is overexpressed in clear cell renal cell carcinoma
17872438 study reports a dominant-negative TLR3 allele in otherwise healthy children with herpes simplex virus 1 encephalitis; TLR3 appears to be redundant in host defense to most microbes but is vital for natural immunity to HSV-1 in the CNS
17851256 Viral dsRNA recognition by TLR3 expressed in airway smooth muscle cells may contribute to airway hyperreactivity by differentially regulating M2R and M3R expression and function.
17805015 Activation of human microglia via Toll-like receptors, particularly TLR3, can change profile of local central nervous system immune responses by translating Th1 polarizing signals to CD4 T cells.
17786279 TLR3 is predominantly expressed on the cell surface of native natural killer cells and becomes rapidly internalized in response to the head and neck squamous cell carcinoma microenvironment.
17703412 Observational study of gene-disease association. (HuGE Navigator)
17660379 Cell type- and species-specific response for TLR stimulation.
17626075 poly(I:C) upregulated TLR3, thereby augmenting the primary (IFN-beta) and secondary (IDO and viperin) response genes
17602875 Flow cytometry showed that the nasal polyp epithelial cell mainly expressed TLR3 in an intracellular compartment; immune response of these cells induced by TLR3 could not be blocked by anti-TLR3 antibody.
17573354 TLR3 is able to sense both single-stranded RNA and dsRNA
17534115 TLR 3 play a distinct role in the inflammatory response that clears viruses from the retina.
17525119 Ability of phenylmethimazole (C10) to decrease growth and migration of papillary thyroid cancer cells may be related to its suppressive effect on TLR3 and Wnt5a signaling.
17521732 These results suggest that the extracellular domains are a crucial trigger of cytoplasmic interferon signaling in TLR3.
17449641 TLR3, PI3K, and IRF3 are involved in the poly IC-induced galectin-9 expression in HUVECs
17434873 Results suggest that N284I and L412F affect the activities of Toll-like receptor 3 needed for proper signaling.
17314152 Observational study of gene-disease association. (HuGE Navigator)
17301562 Observational study of gene-disease association. (HuGE Navigator)
17292969 expression levels of TLR2, TLR3, TLR4 & TLR9 in endometrium varied in a similar pattern during the menstrual cycle; levels were high in perimenstrual period & low in periovulatory period
17254392 A molecular model of TLR# in order to understand the molecular basis of pathogen associated molecular patterns.
17209042 dimer of TLR3 is the form that binds RNA and activates signal transduction.
17178723 Two phosphotyrosine residues of Toll-like receptor 3 (TLR3) activate two distinct pathways, one leading to NF-kappaB release and the other leading to its phosphorylation.
17150911 The interactions between the TLR3 ectodomain and double-stranded RNA depended on acidic pH.
17142772 TLR3 ligands can not only indirectly influence the adaptive immune response through modulation of dendritic cell activation, but also directly increase IFN-gamma production by Ag-specific CD8+ T cells.
17142768 Both the cytoplasmic and TLR3-mediated dsRNA recognition pathways converge upon NAP1 for the activation of the IRF-3 and IFN-beta promoter.
17085778 Human neurons express TLR-3, a major receptor in virus-mediated innate immune response.
17043099 TLR3-mediated production of proinflammatory cytokines and chemokines in oviduct epithelial cells in response to viral dsRNA may be important for antiviral immunity in the human female reproductive tract.
16950283 Evidence of a functional response to TLR ligand TLR3 supports an immunomodulatory role for airway smoooth muscle cells during airway inflammatory responses.
16935934 TLR3 agonist poly(I:C) activated epithelial cells, primary endothelial cells, and two types of primary human smooth muscle cells (airway [ASMC] and vascular) directly, while the TLR7/8 agonist R848 required the presence of leukocytes to activate ASMC
16914605 H. influenzae infection increases airway epithelial cell ICAM-1 and TLR3 expression, leading to enhanced binding of RV and a potentiation of RV-induced chemokine release
16877304 brain neurons can express TLR-3 in vivo and these neurons may play an important role in initiating an inflammatory reaction in a variety of neurological diseases
16858407 TLR3 associates with activated c-Src tyrosine kinase double-stranded (ds)RNA-containing endosomes in HeLa cells, and triggers an innate immune response during viral infection.
16847112 findings demonstrate that TLR-3 and TLR-9 mediate the activation of corneal cells by Herpes simplex virus 1, HSV-1 DNA and HSV-1-antibody complexes
16720699 These mutations locate the dsRNA binding site on the glycan-free, lateral surface of TLR3 toward the C terminus and suggest a model for dsRNA binding and TLR3 activation.
16628196 the STAT1-SOCS1 pathway regulates the innate immune response via TLR3 signaling in epidermal keratinocytes
16585585 direct proapoptotic activity of endogenous TLR3 expressed by cancerous cells
16533755 analysis of glycosylation of human Toll-like receptor 3
16484229 the interaction of IRF-8 with TRAF6 modulates TLR signaling and may contribute to the cross-talk between IFN-gamma and TLR signal pathways
16482523 TLR3 is induced on human astrocytes upon inflammation and when activated, mediates a comprehensive neuroprotective response rather than a polarized pro-inflammatory reaction.
16424203 Respiratory syncytial virus, via an effect on TLR3 and protein kinase R, sensitizes airway epithelial cells to subsequent double-stranded (ds)RNA exposure.
16399790 Exposure of respiratory epithelial cells to diesel exhause enhances virus and could potentially alter the response to viral infections by increasing the expression and function of TLR3.
16293707 The role of TLR3 in the immunobiology of muscle is reported; its implications for the understanding of the pathogenesis of inflammatory myopathies or therapeutic interventions are included.
16289658 required for the activation of NFkappaB by the LTRf from Moloney murine and feline leukemia viruses
16160153 This study demonstrates an important functional requirement for TLR3 in the host response against rhinovirus infection
16146574 The up-regulation of Toll-like receptors 2, 3 and 4 in the nasal mucosa of patients with symptomatic allergic rhinitis supports the idea of a role for Toll-like receptors in allergic airway inflammation.
16144834 TLR3 engagement by poly(I-C) at an acidic pH, probably in early phagolysosomes or endosomes, induces receptor aggregation leading to signaling
16043704 The overall horseshoe-shaped structure of the TLR3-ectodomain is formed by 23 repeating leucine-rich repeats (LRRs) that are capped at each end by specialized non-LRR domains.
16035096 Biliary epithelial cell antibodies via induction of TLR2 and TLR3, as well as inflammatory cytokine and chemokine production may induce epithelial cell inflammatory responses to bacterial components and contribute to posttransplantation cholangitis.
16029432 Observational study of gene-disease association. (HuGE Navigator)
16029432 These results suggest that polymorphisms in the TLR3 gene, which is part of the innate immune system, may be associated with type 1 diabetes in this population.
15972671 TLR3 and TLR4 signal primarily through NF-kappaB to enhance transcription of pIgR mRNA.
15961631 crystal structure of ectodomain; large horseshoe-shaped solenoid assembled from 23 leucine-rich repeats (LRRs)
15935884 TLR3 is involved in the immune responses of endometrial epithelial cells after exposure to dsRNA and has the potential to alter the cytokine milieu and influence the outcome and consequences of infection.
15845391 The gene expression and surface expression of TLR3 in polyI:C-stimulated corneal epithelial cells.
15778392 IFN-alpha-induced up-regulation of TLR3 expression is involved in dsRNA activated antiviral response in human epithelial and endothelial cells
15767394 Toll-like receptor 3, although essential for gene induction by dsRNA, was dispensable for gene induction by Sendai virus
15737993 hepatocytes contain two distinct antiviral signaling pathways leading to expression of intereron beta, one dependent upon TLR3 and the other dependent on RIG-I, with little cross-talk between these pathways
15731229 studies indicate that TLR3 mediates inflammatory cytokine and chemokine production in respiratory syncytial virus-infected epithelial cells.
15652398 Resting and activated human astrocytes preferentially express TLR3, constitutively express adapters linked to TLR3 signaling, and respond to TLR3 engagement with production of TNF-alpha, IL-6, and chemokines.
15579900 TLR3 is constitutively expressed in human alveolar and bronchial epithelial cells; TLR3 contributes directly to the immune response of respiratory epithelial cells to influenza A virus and dsRNA
15502848 dsRNA-activated phosphorylation of two specific tyrosine residues of TLR3 is essential for initiating two distinct signaling pathways
15315972 With expression of TLR3, poly I:C stimulation induces the activation of interferon regulatory factor-3.
15226270 the cytoplasmic linker region of TLR3 regulates receptor retention inside the organelle and signaling
15212709 Data support the hypothesis that toll-like receptor-3 is an important determinant of cellular responses to external double-stranded RNA.
15153468 siRNA and shRNA knockdown of genes represents a new and powerful tool, it is not without nonspecific effects, which we demonstrate are mediated in part by signaling through TLR3.
15119015 This isoform has 2,520 bp cDNAs compared to the 2,712 bp of full cDNA, is produced by deletion of an intron-like sequence within exon 4 and is co-expressed with wild type TLR3 in primary human astrocytes and glioblastoma cell lines.
14987294 Observational study of gene-disease association. (HuGE Navigator)
14982987 double-stranded RNA-induced TLR3/TRIF-mediated NF-kappaB and IRF3 activation diverge at TRIF
14729660 RNA, likely through secondary structure, is a potent host-derived activator of TLR3
14575692 measles virus-induced expression of TLR3 may reflect amplified IFN production that plays a part in host defense to viral infection
14557267 TLR4-mediated activation of the interferon-sensitive response element has an absolute requirement for NFKBp65, whereas the TLR3-induced ISRE response is NFKB-independent
12672806 TLR3 has a role in innate and adaptive immune responses
12509442 the first demonstration of the importance of TLR3 cytoplasmic tyrosine residues in double-stranded RNA signaling

AA Sequence

MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAAN      1 - 70
FTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKN     71 - 140
NPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIK    141 - 210
EFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLD    211 - 280
LSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFS    281 - 350
FQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKIS    351 - 420
KIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRV    421 - 490
ALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKG    491 - 560
LSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVF    561 - 630
GPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSA    631 - 700
PFELFFMINTSILLIFIFIVLLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWV    701 - 770
WEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAI    771 - 840
EQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH          841 - 904
//

Text Mined References (492)

PMID Year Title
26797279 2016 Activation of the phosphatidylinositol 3-kinase/Akt pathway by viral interferon regulatory factor 2 of Kaposi's sarcoma-associated herpesvirus.
26646717 2015 Human ?-Defensin 3 [corrected] Exacerbates MDA5 but Suppresses TLR3 Responses to the Viral Molecular Pattern Mimic Polyinosinic:Polycytidylic Acid.
26589477 2016 TLR3 activation increases chemokine expression in human fetal airway smooth muscle cells.
26584291 2015 Role of Toll-Like Receptor 3 Gene Polymorphisms in Preeclampsia.
26536229 2015 Expression of CCL20 and Its Corresponding Receptor CCR6 Is Enhanced in Active Inflammatory Bowel Disease, and TLR3 Mediates CCL20 Expression in Colonic Epithelial Cells.
26512422 2015 Role of TLR gene expression and cytokine profiling in the immunopathogenesis of viral hepatitis E.
26466955 2015 LRRC59 Regulates Trafficking of Nucleic Acid-Sensing TLRs from the Endoplasmic Reticulum via Association with UNC93B1.
26418032 2015 Synergistic Proinflammatory Responses by IL-17A and Toll-Like Receptor 3 in Human Airway Epithelial Cells.
26417991 2015 Synthetic Double-Stranded RNA Poly(I:C) Aggravates IgA Nephropathy by Triggering IgA Class Switching Recombination through the TLR3-BAFF Axis.
26367324 2015 Interleukin-24 inhibits influenza A virus replication in vitro through induction of toll-like receptor 3 dependent apoptosis.
26318769 2016 Polymorphisms of the Toll-Like Receptor-3 Gene in Autoimmune Adrenal Failure and Type 1 Diabetes in Polish Patients.
26313906 2015 Type I Interferons Function as Autocrine and Paracrine Factors to Induce Autotaxin in Response to TLR Activation.
26303210 2015 TLR3 drives IRF6-dependent IL-23p19 expression and p19/EBI3 heterodimer formation in keratinocytes.
26298326 2015 Toll-like receptor-3 gene polymorphism in patients with Japanese encephalitis.
26296370 2015 Activation of TLR3/interferon signaling pathway by bluetongue virus results in HIV inhibition in macrophages.
26255864 2015 Type I IFN-mediated synergistic activation of mouse and human DC subsets by TLR agonists.
26253200 2015 dsRNA Released by Tissue Damage Activates TLR3 to Drive Skin Regeneration.
26238371 2015 TLR3 and TLR4 But not TLR2 are Involved in Vogt-Koyanagi- Harada Disease by Triggering Proinflammatory Cytokines Production Through Promoting the Production of Mitochondrial Reactive Oxygen Species.
26226228 2015 A Prospective Evaluation of the Association between a Single Nucleotide Polymorphism rs3775291 in Toll-Like Receptor 3 and Breast Cancer Relapse.
26208481 2015 MDA5 complements TLR3 in suppression of neuroblastoma.
26172457 2015 EBV-encoded RNA via TLR3 induces inflammation in nasopharyngeal carcinoma.
26123900 2015 Toll-like receptor 3 expression and function in childhood idiopathic nephrotic syndrome.
26100173 2015 Cigarette smoke augments MUC5AC production via the TLR3-EGFR pathway in airway epithelial cells.
26077030 2015 An inhibitory alternative splice isoform of Toll-like receptor 3 is induced by type I interferons in human astrocyte cell lines.
26024592 2015 Genetic polymorphisms in Toll-like receptor 3 gene are associated with the risk of hepatitis B virus-related liver diseases in a Chinese population.
25992926 Toll-like receptor 3 gene polymorphisms are not associated with the risk of hepatitis B and hepatitis C virus infection.
25918231 2015 Toll-Like Receptor 3 Influences Glucose Homeostasis and ?-Cell Insulin Secretion.
25912131 2015 Toll-like receptors 3, 7, and 9 in Juvenile nasopharyngeal angiofibroma.
25880109 2015 RIG-I and TLR3 are both required for maximum interferon induction by influenza virus in human lung alveolar epithelial cells.
25867514 2015 TLR-3 is present in human adipocytes, but its signalling is not required for obesity-induced inflammation in adipose tissue in vivo.
25794662 2015 Tonsil-derived mesenchymal stromal cells produce CXCR2-binding chemokines and acquire follicular dendritic cell-like phenotypes under TLR3 stimulation.
25780039 2015 A role for APPL1 in TLR3/4-dependent TBK1 and IKK? activation in macrophages.
25754930 2015 Up-regulation of galectin-9 induces cell migration in human dendritic cells infected with dengue virus.
25754842 2015 TLR3/TRIF signalling pathway regulates IL-32 and IFN-? secretion through activation of RIP-1 and TRAF in the human cornea.
25736436 2015 WDFY1 mediates TLR3/4 signaling by recruiting TRIF.
25720507 2015 A toll-like receptor 3 single nucleotide polymorphism in Japanese patients with sarcoidosis.
25695694 2015 The role of Toll-like receptor 3 and 4 in regulating the function of mesenchymal stem cells isolated from umbilical cord.
25689620 2015 Galectin-3 is a sensor-regulator of toll-like receptor pathways in synovial fibroblasts.
25668563 2015 Cellular mechanisms of toll-like receptor-3 activation in the thalamus are associated with white matter injury in the developing brain.
25652132 2015 Roflumilast improves corticosteroid resistance COPD bronchial epithelial cells stimulated with toll like receptor 3 agonist.
25641411 2015 Scavenger receptor SREC-I promotes double stranded RNA-mediated TLR3 activation in human monocytes.
25605704 2015 Activation of Toll-like receptor 3 reduces actin polymerization and adhesion molecule expression in endometrial cells, a potential mechanism for viral-induced implantation failure.
25594115 2015 Expression and functionality of Toll-like receptor 3 in the megakaryocytic lineage.
25471749 2015 Toll-like receptor 3 signaling contributes to the expression of a neutrophil chemoattractant, CXCL1 in human mesangial cells.
25452586 2014 Loss of TLR3 aggravates CHIKV replication and pathology due to an altered virus-specific neutralizing antibody response.
25444175 2015 TLR3 engagement induces IRF-3-dependent apoptosis in androgen-sensitive prostate cancer cells and inhibits tumour growth in vivo.
25436985 Toll-like receptor 3 and interleukin 1? expression in CD34+ cells from patients with rheumatoid arthritis: association with inflammation and vascular involvement.
25423559 2015 The role of Toll-like receptor polymorphisms in acute pancreatitis occurrence and severity.
25388852 2015 Evaluation of neonatal Toll-like receptors 3 (c.1377C/T) and 9 (G2848A) gene polymorphisms in HBV intrauterine transmission susceptibility.
25373689 2014 Involvement of Toll-like receptors in cervical cancer susceptibility among Tunisian women.
25348355 2015 Innate adjuvant receptor Toll-like receptor 3 can promote breast cancer through cell surface.
25339207 2014 TLR3 deficiency in herpes simplex encephalitis: high allelic heterogeneity and recurrence risk.
25309919 2014 Cervical cancer cell supernatants induce a phenotypic switch from U937-derived macrophage-activated M1 state into M2-like suppressor phenotype with change in Toll-like receptor profile.
25304972 2014 A non-synonymous single-nucleotide polymorphism in the gene encoding Toll-like Receptor 3 (TLR3) is associated with sero-negative rheumatoid arthritis (RA) in a Danish population.
25257174 2015 ?-Catenin and NF-?B co-activation triggered by TLR3 stimulation facilitates stem cell-like phenotypes in breast cancer.
25226020 2014 Polymorphisms in chemokine receptor 5 and Toll-like receptor 3 genes are risk factors for clinical tick-borne encephalitis in the Lithuanian population.
25217833 2014 Toll-like receptor 3 transmembrane domain is able to perform various homotypic interactions: an NMR structural study.
25214272 [The role of TLR-2, TLR-3, TLR-4 genes polymorphism of grippe].
25204797 2014 Flotillin-1 facilitates toll-like receptor 3 signaling in human endothelial cells.
25171218 2014 A functional polymorphism in the promoter region of TLR3 is associated with susceptibility to end-stage renal disease.
25171086 2014 ?Np63 controls a TLR3-mediated mechanism that abundantly provides thymic stromal lymphopoietin in atopic dermatitis.
25127040 2014 Toll-like receptor-3 is dispensable for the innate microRNA response to West Nile virus (WNV).
25126563 2014 Modulation of TLR 3, 7 and 8 expressions in HCV genotype 3 infected individuals: potential correlations of pathogenesis and spontaneous clearance.
25121361 A pilot study on expression of toll like receptors (TLRs) in response to herpes simplex virus (HSV) infection in acute retinal pigment epithelial cells (ARPE) cells.
25098814 2014 Toll-like receptor 3 stimulation promotes Ro52/TRIM21 synthesis and nuclear redistribution in salivary gland epithelial cells, partially via type I interferon pathway.
25092290 2014 LL-37 peptide enhancement of signal transduction by Toll-like receptor 3 is regulated by pH: identification of a peptide antagonist of LL-37.
25008898 2014 Hepatitis C virus infection decreases the expression of Toll-like receptors 3 and 7 via upregulation of miR-758.
24934575 2014 Toll-like receptor 3 inhibits Newcastle disease virus replication through activation of pro-inflammatory cytokines and the type-1 interferon pathway.
24905199 2014 dsRNA-activation of TLR3 and RLR signaling: gene induction-dependent and independent effects.
24889229 2014 Abrogation of TLR3 inhibition by discrete amino acid changes in the C-terminal half of the West Nile virus NS1 protein.
24886842 2014 Functional effects of Toll-like receptor (TLR)3, 7, 9, RIG-I and MDA-5 stimulation in nasal epithelial cells.
24845156 2014 Inflammatory unbalance of TLR3 and TLR4 in PCI patients with or without type 2 diabetes mellitus.
24819172 2014 Association between Toll-like receptor 3 polymorphisms and cancer risk: a meta-analysis.
24791904 2014 AP1S3 mutations are associated with pustular psoriasis and impaired Toll-like receptor 3 trafficking.
24786223 2014 UVB radiation illuminates the role of TLR3 in the epidermis.
24768503 2014 Exonic single nucleotide polymorphisms within TLR3 associated with infant responses to serogroup C meningococcal conjugate vaccine.
24766260 2014 Polymorphisms of toll-like receptors 2, 3 and 4 in patients that do and do not enter labour spontaneously at term.
24760149 2014 TLR3 activation augments matrix metalloproteinase production through reactive nitrogen species generation in human lung fibroblasts.
24739633 2014 Mucosal toll-like receptor 3-dependent synthesis of complement factor B and systemic complement activation in inflammatory bowel disease.
24719229 2014 Genetic polymorphisms of dsRNA ligating pattern recognition receptors TLR3, MDA5, and RIG-I. Association with systemic lupus erythematosus and clinical phenotypes.
24712925 2014 Reduced expression of TLR3, TLR10 and TREM1 by human macrophages in Chronic cavitary pulmonary aspergillosis, and novel associations of VEGFA, DENND1B and PLAT.
24709775 2014 Regulatory phenotype, PD-1 and TLR3 expression in T cells and monocytes from HCV patients undergoing antiviral therapy: a randomized clinical trial.
24708416 2014 Interleukin-17 increases the expression of Toll-like receptor 3 via the STAT3 pathway in rheumatoid arthritis fibroblast-like synoviocytes.
24701034 2014 Hantaan virus infection induces CXCL10 expression through TLR3, RIG-I, and MDA-5 pathways correlated with the disease severity.
24693944 2014 MUC1 regulates epithelial inflammation and apoptosis by PolyI:C through inhibition of Toll/IL-1 receptor-domain-containing adapter-inducing IFN-? (TRIF) recruitment to Toll-like receptor 3.
24692849 2014 Expression of toll-like receptors 3, 7, and 9 in peripheral blood mononuclear cells from patients with systemic lupus erythematosus.
24682730 2014 Does toll-like receptor-3 (TLR-3) have any role in Indian AMD phenotype?
24672048 2014 Enterovirus 68 3C protease cleaves TRIF to attenuate antiviral responses mediated by Toll-like receptor 3.
24651829 2014 The ectodomain of TLR3 receptor is required for its plasma membrane translocation.
24651439 2014 Defects in TLR3 expression and RNase L activation lead to decreased MnSOD expression and insulin resistance in muscle cells of obese people.
24565447 2014 Toll-like receptors in the depressed and suicide brain.
24558379 2014 Toll-like receptor 3 signalling up-regulates expression of the HIV co-receptor G-protein coupled receptor 15 on human CD4+ T cells.
24535857 2014 Toll-like receptor 3 polymorphism is not associated with neovascular age-related macular degeneration and polypoidal choroidal vasculopathy in the Chinese.
24530528 2014 Mannan binding lectin attenuates double-stranded RNA-mediated TLR3 activation and innate immunity.
24524192 2014 Beyond dsRNA: Toll-like receptor 3 signalling in RNA-induced immune responses.
24445780 2014 Genetic variations in Toll-like receptors (TLRs 3/7/8) are associated with systemic lupus erythematosus in a Taiwanese population.
24408902 2014 Polymorphisms in the TLR3 gene are associated with risk for type 1 diabetes mellitus.
24371259 2014 Mutations in toll-like receptor 3 are associated with elevated levels of rotavirus-specific IgG antibodies in IgA-deficient but not IgA-sufficient individuals.
24321786 2014 Autophagy facilitates TLR4- and TLR3-triggered migration and invasion of lung cancer cells through the promotion of TRAF6 ubiquitination.
24286242 2013 IL-29 enhances Toll-like receptor-mediated IL-6 and IL-8 production by the synovial fibroblasts from rheumatoid arthritis patients.
24198284 2013 An alanine-to-proline mutation in the BB-loop of TLR3 Toll/IL-1R domain switches signalling adaptor specificity from TRIF to MyD88.
24165198 2013 SORBS2 and TLR3 induce premature senescence in primary human fibroblasts and keratinocytes.
24155891 2013 IL-27 enhances the expression of TRAIL and TLR3 in human melanomas and inhibits their tumor growth in cooperation with a TLR3 agonist poly(I:C) partly in a TRAIL-dependent manner.
24146036 2014 TLR3 and TLR4 as potential clinically biomarkers of cardiovascular risk in coronary artery disease (CAD) patients.
24131248 2014 TLR3 and MDA5 signalling, although not expression, is impaired in asthmatic epithelial cells in response to rhinovirus infection.
24105952 2014 The toll-like receptor 3 ligand, poly(I:C), improves immunosuppressive function and therapeutic effect of mesenchymal stem cells on sepsis via inhibiting MiR-143.
24084648 2013 Depletion of the 26S proteasome adaptor Ecm29 increases Toll-like receptor 3 signaling.
24070541 2013 The Toll-like receptor 3 L412F polymorphism and disease progression in idiopathic pulmonary fibrosis.
24068346 2014 TLR2, TLR3, and TLR4 activation specifically alters the oxidative status of intestinal epithelial cells.
24028589 2013 TLR2, TLR3, TLR4 and CD14 gene polymorphisms associated with oral lichen planus risk.
23962581 2013 Association between TLR3 rs3775291 and resistance to HIV among highly exposed Caucasian intravenous drug users.
23948864 2014 Shockwave therapy differentially stimulates endothelial cells: implications on the control of inflammation via toll-Like receptor 3.
23946637 2013 Increase in peripheral blood mononuclear cell Toll-like receptor 2/3 expression and reactivity to their ligands in a cohort of patients with wet age-related macular degeneration.
23908180 2013 Higher expression of Toll-like receptors 2, 3, 4, and 8 in ocular Behcet's disease.
23845419 2013 TLR3 mediates release of IL-1? and cell death in keratinocytes in a caspase-4 dependent manner.
23844087 2013 TLR3-induced placental miR-210 down-regulates the STAT6/interleukin-4 pathway.
23817958 2013 Proinflammatory stimuli induce galectin-9 in human mesenchymal stromal cells to suppress T-cell proliferation.
23796347 2014 Association of TLR2, TLR3, TLR4 and CD14 genes polymorphisms with oral cancer risk and survival.
23748743 2013 Toll-like receptor 3 regulates cord blood-derived endothelial cell function in vitro and in vivo.
23744559 2013 Reduced Toll-like receptor 3 expression in chronic hepatitis B patients and its restoration by interferon therapy.
23723066 2013 TLR-TRIF pathway enhances the expression of KSHV replication and transcription activator.
23721942 2013 Association of single nucleotide polymorphism rs3775291 in the coding region of the TLR3 gene with predisposition to tick-borne encephalitis in a Russian population.
23717201 2013 Class A scavenger receptor 1 (MSR1) restricts hepatitis C virus replication by mediating toll-like receptor 3 recognition of viral RNAs produced in neighboring cells.
23716670 2013 Toll-like receptor 3 (TLR3) activation induces microRNA-dependent reexpression of functional RAR? and tumor regression.
23673618 2013 Toll-like receptor 3 recognizes incomplete stem structures in single-stranded viral RNA.
23668802 2013 Expression of Toll-like receptor-3 is enhanced in active inflammatory bowel disease and mediates the excessive release of lipocalin 2.
23647955 2013 Induction of interferon-? contributes to Toll-like receptor-3-activated hepatic stellate cell-mediated hepatitis C virus inhibition in hepatocytes.
23548575 2013 Toll-like receptor 3 expression in glia and neurons alters in response to white matter injury in preterm infants.
23541683 2013 Toll-like receptor 3 expression inhibits cell invasion and migration and predicts a favorable prognosis in neuroblastoma.
23534905 2013 TLR-mediated induction of proinflammatory cytokine IL-32 in corneal epithelium.
23497334 2013 Smoking decreases the response of human lung macrophages to double-stranded RNA by reducing TLR3 expression.
23489702 In vivo liver expression of TLR2, TLR3 and TLR7 in chronic hepatitis C.
23467704 2013 The expression and function of Toll-like receptors 3 and 9 in human colon carcinoma.
23425350 2013 Toll-like receptor 3 and 7/8 function is impaired in hepatitis C rapid fibrosis progression post-liver transplantation.
23404408 2013 Toll-like receptor 3 genetic variants and susceptibility to hepatocellular carcinoma and HBV-related hepatocellular carcinoma.
23396947 2013 A novel IRAK1-IKK? signaling axis limits the activation of TAK1-IKK? downstream of TLR3.
23369718 2013 Recognition of pathogen-associated nucleic acids by endosomal nucleic acid-sensing toll-like receptors.
23353987 2013 Activation of TLR3 in keratinocytes increases expression of genes involved in formation of the epidermis, lipid accumulation, and epidermal organelles.
23290562 2013 TLR3 immunity to infection in mice and humans.
23269203 2013 The innate immune adaptor MyD88 is dispensable for spontaneous autoimmune demyelination in a mouse model of multiple sclerosis.
23255358 2013 Cleaved/associated TLR3 represents the primary form of the signaling receptor.
23255072 2013 Association of a functional polymorphism in the promoter region of TLR-3 with osteoarthritis: a two-stage case-control study.
23245579 2013 TLR3 ligation protects human astrocytes against oxidative stress.
23240626 2013 Association between a functional polymorphism in Toll-like receptor 3 and chronic hepatitis C in liver transplant recipients.
23220997 2013 Impaired toll-like receptor 3-mediated immune responses from macrophages of patients chronically infected with hepatitis C virus.
23179584 2013 Expression of TLR3, 4, 7 and 9 in cutaneous malignant melanoma: relationship with clinicopathological characteristics and prognosis.
23166319 2013 The role of UNC93B1 protein in surface localization of TLR3 receptor and in cell priming to nucleic acid agonists.
23151015 2012 Toll-like receptor 3 gene polymorphisms and severity of pandemic A/H1N1/2009 influenza in otherwise healthy children.
23115281 2013 The viral interferon regulatory factors of kaposi's sarcoma-associated herpesvirus differ in their inhibition of interferon activation mediated by toll-like receptor 3.
23103873 2012 Impaired intrinsic immunity to HSV-1 in human iPSC-derived TLR3-deficient CNS cells.
23076446 2013 Association of Toll-like receptor 3 polymorphisms with chronic hepatitis B and hepatitis B-related acute-on-chronic liver failure.
23056470 2012 TRIM38 negatively regulates TLR3-mediated IFN-? signaling by targeting TRIF for degradation.
23056170 2012 RO 90-7501 enhances TLR3 and RLR agonist induced antiviral response.
23053995 2012 Toll-like receptor 3: implications for proinflammatory microenvironment in human breast cancer.
22989785 2013 Induction of CXCL10 chemokine in adrenocortical cells by stimulation through toll-like receptor 3.
22960172 2012 Viral Toll Like Receptor activation of pulmonary vascular smooth muscle cells results in endothelin-1 generation; relevance to pathogenesis of pulmonary arterial hypertension.
22950839 2012 TNF? enhances TLR3-dependent effects on MMP-9 expression in human mesangial cells.
22948160 2012 TRIM56 is an essential component of the TLR3 antiviral signaling pathway.
22944378 2012 Increased expression of Toll-like receptor 3 in decidual natural killer cells of patients with unexplained recurrent spontaneous miscarriage.
22912896 2012 HLA-A*0206 with TLR3 polymorphisms exerts more than additive effects in Stevens-Johnson syndrome with severe ocular surface complications.
22865861 2012 Proteolytic processing regulates Toll-like receptor 3 stability and endosomal localization.
22864531 2012 Response of VEGF to activation of viral receptors and TNF? in human mesangial cells.
22851595 2012 Heterozygous TBK1 mutations impair TLR3 immunity and underlie herpes simplex encephalitis of childhood.
22849850 2012 25-Hydroxycholesterol enhances cytokine release and Toll-like receptor 3 response in airway epithelial cells.
22825813 2012 Toll-like receptor 3 polymorphism and its association with hepatitis B virus infection in Saudi Arabian patients.
22771581 2012 Toll-like receptor (TLR) 3 as a surrogate sensor of retroviral infection in human cells.
22762377 2012 Double-stranded RNA induces IL-8 and MCP-1 gene expression via TLR3 in HaCaT-keratinocytes.
22759966 2012 Toll-like receptor 3 activation affects serotonin transporter activity and expression in human enterocyte-like Caco-2 cells.
22745793 2012 Toll-like receptor 3 and suppressor of cytokine signaling proteins regulate CXCR4 and CXCR7 expression in bone marrow-derived human multipotent stromal cells.
22685032 2013 Enhanced expression of CXCL10 in inflammatory bowel disease: potential role of mucosal Toll-like receptor 3 stimulation.
22611194 2012 Cleavage of Toll-like receptor 3 by cathepsins B and H is essential for signaling.
22591330 2012 Cigarette smoke augments the expression and responses of toll-like receptor 3 in human macrophages.
22590509 2012 Triggering of the dsRNA sensors TLR3, MDA5, and RIG-I induces CD55 expression in synovial fibroblasts.
22579623 2012 Lateral clustering of TLR3:dsRNA signaling units revealed by TLR3ecd:3Fabs quaternary structure.
22572822 2012 Toll-like receptor 3 ligand polyinosinic:polycytidylic acid promotes wound healing in human and murine skin.
22568929 2012 Activation of Toll-like receptor 3 induces apoptosis of oral squamous carcinoma cells in vitro and in vivo.
22552940 2012 Polymorphisms in Toll-like receptor 3 confer natural resistance to human herpes simplex virus type 2 infection.
22549436 2012 Toll-like receptor 3 L412F polymorphisms in infants with bronchiolitis and postbronchiolitis wheezing.
22537752 2012 Association of TLR3-hyporesponsiveness and functional TLR3 L412F polymorphism with recurrent herpes labialis.
22504413 2012 TLR3 and RIG-I gene variants: associations with functional effects on receptor expression and responses to measles virus and vaccine in vaccinated infants.
22479513 2012 Tyrosine phosphorylation of the E3 ubiquitin ligase TRIM21 positively regulates interaction with IRF3 and hence TRIM21 activity.
22466005 2012 TLR3-dependent immune regulatory functions of human mesangial cells.
22457005 2013 TLR3-mediated apoptosis and activation of phosphorylated Akt in the salivary gland epithelial cells of primary Sjögren's syndrome patients.
22429150 2012 Inflammation and Toll-like receptor ligation differentially affect the osteogenic potential of human mesenchymal stromal cells depending on their tissue origin.
22421964 2012 dsRNA induces apoptosis through an atypical death complex associating TLR3 to caspase-8.
22421267 2012 Epistatic interaction between Toll-like receptor 3 (TLR3) and prostaglandin E receptor 3 (PTGER3) genes.
22415225 2012 Poly(I:C) treatment influences the expression of calreticulin and profilin-1 in a human HNSCC cell line: a proteomic study.
22323545 2012 A TRIF-independent branch of TLR3 signaling.
22310660 2012 Rb/E2F1 regulates the innate immune receptor Toll-like receptor 3 in epithelial cells.
22260507 2012 Toll-like receptor (TLR) 3 immune modulation by unformulated small interfering RNA or DNA and the role of CD14 (in TLR-mediated effects).
22205660 2012 Single nucleotide polymorphisms in the Toll-like receptor 3 and CD44 genes are associated with persistence of vaccine-induced immunity to the serogroup C meningococcal conjugate vaccine.
22205631 2012 Negative control of TLR3 signaling by TICAM1 down-regulation.
22200507 2012 Toll-like receptor 3-elicited MAPK activation induces stabilization of interferon-? mRNA.
22174453 2012 A common polymorphism in TLR3 confers natural resistance to HIV-1 infection.
22147891 2012 TLR3 essentially promotes protective class I-restricted memory CD8? T-cell responses to Aspergillus fumigatus in hematopoietic transplanted patients.
22102050 2011 Crystallization of a challenging antigen-antibody complex: TLR3 ECD with three noncompeting Fabs.
22070917 2012 Toll-like receptor 3-mediated tumor invasion in head and neck cancer.
22065573 2011 Nuclear factor ?B subunits RelB and cRel negatively regulate Toll-like receptor 3-mediated ?-interferon production via induction of transcriptional repressor protein YY1.
22057682 2012 Induction of interferon-? contributes to Toll-like receptor 3-mediated herpes simplex virus type 1 inhibition in astrocytes.
22039520 2011 LL37 and cationic peptides enhance TLR3 signaling by viral double-stranded RNAs.
22038398 2012 Roles of the PI3K/Akt pathway and autophagy in TLR3 signaling-induced apoptosis and growth arrest of human prostate cancer cells.
22030901 2012 Activation of chemokine and inflammatory cytokine response in hepatitis C virus-infected hepatocytes depends on Toll-like receptor 3 sensing of hepatitis C virus double-stranded RNA intermediates.
22024499 2012 The biological significance of TLR3 variant, L412F, in conferring susceptibility to cutaneous candidiasis, CMV and autoimmunity.
22016778 2011 Viral double-strand RNA-binding proteins can enhance innate immune signaling by toll-like Receptor 3.
21998457 2011 The TLR3/TICAM-1 pathway is mandatory for innate immune responses to poliovirus infection.
21990957 2011 Overexpression of TLR3, TLR4, TLR7 and TLR9 in esophageal squamous cell carcinoma.
21978158 2011 Blockade of Lyn kinase upregulates both canonical and non-canonical TLR-3 pathways in THP-1 monocytes exposed to human cytomegalovirus.
21960283 2012 Expression of toll-like receptors 2 and 3 on esophageal epithelial cell lines and on eosinophils during esophagitis.
21952237 2011 Toll-like receptor-3 ligation-induced indoleamine 2, 3-dioxygenase expression in human trophoblasts.
21949112 2011 Heterotrimeric Gi/Go proteins modulate endothelial TLR signaling independent of the MyD88-dependent pathway.
21931545 2011 Disruption of TLR3 signaling due to cleavage of TRIF by the hepatitis A virus protease-polymerase processing intermediate, 3CD.
21911973 2011 Promoter region polymorphism & expression profile of toll like receptor-3 (TLR-3) gene in chronic hepatitis C virus (HCV) patients from India.
21911501 2011 Toll-like receptor 3 (TLR3) signaling requires TLR4 Interactor with leucine-rich REPeats (TRIL).
21911422 2011 Herpes simplex virus encephalitis in a patient with complete TLR3 deficiency: TLR3 is otherwise redundant in protective immunity.
21847628 2011 Interleukin 29 enhances expression of Toll receptor 3 and mediates antiviral signals in human keratinocytes.
21844166 2011 TLR7/9 versus TLR3/MDA5 signaling during virus infections and diabetes.
21843566 2011 Expression of toll-like receptor TLR-2, TLR-3, TLR-4 and TLR-9 is increased in placentas from patients with preeclampsia.
21839239 Toll-like receptor 3 L412F polymorphism may protect against acute graft rejection in adult patients undergoing liver transplantation for hepatitis C-related cirrhosis.
21829730 2011 Activation of Toll-like receptor 3 impairs the dengue virus serotype 2 replication through induction of IFN-? in cultured hepatoma cells.
21802664 2011 Synergy between TLR3 and IL-18 promotes IFN-? dependent TRAIL expression in human liver NK cells.
21737330 2011 cIAPs block Ripoptosome formation, a RIP1/caspase-8 containing intracellular cell death complex differentially regulated by cFLIP isoforms.
21735101 2011 The dual role of TLR3 in metastatic cell line.
21730023 2011 TLR4 engagement during TLR3-induced proinflammatory signaling in dendritic cells promotes IL-10-mediated suppression of antitumor immunity.
21722947 2011 NEMO is a key component of NF-?B- and IRF-3-dependent TLR3-mediated immunity to herpes simplex virus.
21712495 2011 Toll-like receptor 3 C1234T may protect against geographic atrophy through decreased dsRNA binding capacity.
21708001 2011 Arthritis is associated with T-cell-induced upregulation of Toll-like receptor 3 on synovial fibroblasts.
21695056 2011 The ubiquitin-like protein PLIC-1 or ubiquilin 1 inhibits TLR3-Trif signaling.
21691053 2012 Viral stimuli trigger exaggerated thymic stromal lymphopoietin expression by chronic obstructive pulmonary disease epithelium: role of endosomal TLR3 and cytosolic RIG-I-like helicases.
21646299 2011 Insulin-dependent phosphatidylinositol 3-kinase/Akt and ERK signaling pathways inhibit TLR3-mediated human bronchial epithelial cell apoptosis.
21623661 2011 Toll-like receptor 3 gene expression in Egyptian patients with glomerulonephritis and hepatitis C virus infection.
21563279 2011 Toll-like receptor-3-activated human mesenchymal stromal cells significantly prolong the survival and function of neutrophils.
21515789 2011 Painful pathways induced by TLR stimulation of dorsal root ganglion neurons.
21498625 2011 Bacterial LPS up-regulated TLR3 expression is critical for antiviral response in human monocytes: evidence for negative regulation by CYLD.
21481769 2011 The structural biology of Toll-like receptors.
21474651 2011 Toll-like receptor 3 signaling enables human esophageal epithelial cells to sense endogenous danger signals released by necrotic cells.
21454254 2011 TLR3-dependent regulation of cytokines in human mesangial cells: a novel role for IP-10 and TNF-alpha in hepatitis C-associated glomerulonephritis.
21398612 2011 Mechanism of endosomal TLR inhibition by antimalarial drugs and imidazoquinolines.
21367858 2011 Toll-like receptor 3 (TLR3) induces apoptosis via death receptors and mitochondria by up-regulating the transactivating p63 isoform alpha (TAP63alpha).
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
21255094 2011 Filaggrin knockdown and Toll-like receptor 3 (TLR3) stimulation enhanced the production of thymic stromal lymphopoietin (TSLP) from epidermal layers.
21245912 2011 RIG-I, MDA5 and TLR3 synergistically play an important role in restriction of dengue virus infection.
21239167 2011 TLR-3 polymorphism is an independent prognostic marker for stage II colorectal cancer.
21223583 2011 Toll-like receptor 3 upregulation by type I interferon in healthy and scleroderma dermal fibroblasts.
21220319 2011 Unexpected protective role for Toll-like receptor 3 in the arterial wall.
21216866 2011 A functional Toll-like receptor 3 gene (TLR3) may be a risk factor for tick-borne encephalitis virus (TBEV) infection.
21189260 2011 TBK1-associated protein in endolysosomes (TAPE) is an innate immune regulator modulating the TLR3 and TLR4 signaling pathways.
21179282 2010 Engagement of toll-like receptor 3 induces vascular endothelial growth factor and interleukin-8 in human rheumatoid synovial fibroblasts.
21173679 2011 Is it time to study TLR3 or UNC-93B pathway deficiencies in reactivated herpes simplex encephalitis?
21148036 2011 Double-stranded RNA induces shedding of the 34-kDa soluble TNFR1 from human airway epithelial cells via TLR3-TRIF-RIP1-dependent signaling: roles for dual oxidase 2- and caspase-dependent pathways.
21132533 2011 Evaluation of Toll-like receptors 3 (c.1377C/T) and 9 (G2848A) gene polymorphisms in cervical cancer susceptibility.
21129170 2010 Study of TLR3, TLR4 and TLR9 in breast carcinomas and their association with metastasis.
21093032 2011 The L412F variant of Toll-like receptor 3 (TLR3) is associated with cutaneous candidiasis, increased susceptibility to cytomegalovirus, and autoimmunity.
21079408 2011 Toll-like receptor 3 polymorphism rs3775291 is not associated with choroidal neovascularization or polypoidal choroidal vasculopathy in Chinese subjects.
21061265 2011 Hodgkin disease risk: role of genetic polymorphisms and gene-gene interactions in inflammation pathway genes.
20978888 2011 Study of TLR3, TLR4, and TLR9 in prostate carcinomas and their association with biochemical recurrence.
20977567 2011 Polymorphism in 3'-untranslated region of toll-like receptor 4 gene is associated with protection from hepatitis B virus recurrence after liver transplantation.
20957750 2010 TLR3-mediated IFN-? gene induction is negatively regulated by the TLR adaptor MyD88 adaptor-like.
20855885 2010 Secretion of the human Toll-like receptor 3 ectodomain is affected by single nucleotide polymorphisms and regulated by Unc93b1.
20832341 2010 Human TRAF3 adaptor molecule deficiency leads to impaired Toll-like receptor 3 response and susceptibility to herpes simplex encephalitis.
20819670 2010 Expression of soluble Toll-like receptors in pleural effusions.
20691286 2011 Toll-like receptor-3-induced mitochondrial dysfunction in cultured human hepatocytes.
20685081 2010 Salivary epithelial cells from Sjogren's syndrome patients are highly sensitive to anoikis induced by TLR-3 ligation.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20651983 2010 Toll-like receptor 3 regulates angiogenesis and apoptosis in prostate cancer cell lines through hypoxia-inducible factor 1 alpha.
20639488 2010 TLR3 and Rig-like receptor on myeloid dendritic cells and Rig-like receptor on human NK cells are both mandatory for production of IFN-gamma in response to double-stranded RNA.
20636339 2010 A critical function of toll-like receptor-3 in the induction of anti-human immunodeficiency virus activities in macrophages.
20604744 2010 A comprehensive genotype-phenotype interaction of different Toll-like receptor variations in a renal transplant cohort.
20595247 2010 Polymorphisms of innate pattern recognition receptors, response to interferon-beta and development of neutralizing antibodies in multiple sclerosis patients.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20523058 2010 Cooperative activation of CCL5 expression by TLR3 and tumor necrosis factor-alpha or interferon-gamma through nuclear factor-kappaB or STAT-1 in airway epithelial cells.
20514466 2010 Toll-like receptor 3 signaling induces apoptosis in human head and neck cancer via survivin associated pathway.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20483774 2010 The microtubule regulator stathmin is an endogenous protein agonist for TLR3.
20483744 2010 TLR stimulation of prostate tumor cells induces chemokine-mediated recruitment of specific immune cell types.
20483009 2010 Investigation of the [-/A]8 and C1236T genetic variations within the human Toll-like receptor 3 gene for association with multiple sclerosis.
20472559 2010 A role for Toll-like receptor 3 variants in host susceptibility to enteroviral myocarditis and dilated cardiomyopathy.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20422193 2011 The investigation of toll-like receptor 3, 9 and 10 gene polymorphisms in Turkish rheumatoid arthritis patients.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20406303 2010 Inhibition of DC-SIGN-mediated transmission of human immunodeficiency virus type 1 by Toll-like receptor 3 signalling in breast milk macrophages.
20381870 2010 Progression of geographic atrophy and genotype in age-related macular degeneration.
20367642 2010 TLR3 induction by anticancer drugs potentiates poly I:C-induced tumor cell apoptosis.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20309865 2010 Expression of Toll-like receptor 3 and Toll-like receptor 7 in muscle is characteristic of inflammatory myopathy and is differentially regulated by Th1 and Th17 cytokines.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20227302 2010 Polymorphisms in innate immunity genes associated with development of bronchiolitis obliterans after lung transplantation.
20200155 2010 Analysis of a TIR-less splice variant of TRIF reveals an unexpected mechanism of TLR3-mediated signaling.
20197609 2010 [TLR3c.1377, TLR9-1486, and TLR9 2848 gene polymorphisms and multiple sclerosis].
20194452 2010 Multiplex screening of 22 single-nucleotide polymorphisms in 7 Toll-like receptors: an association study in rheumatoid arthritis.
20124101 2010 TLR activation pathways in HIV-1-exposed seronegative individuals.
20100933 2010 Age-associated decrease in TLR function in primary human dendritic cells predicts influenza vaccine response.
20047764 2010 Direct binding of TRAF2 and TRAF6 to TICAM-1/TRIF adaptor participates in activation of the Toll-like receptor 3/4 pathway.
20009359 2010 Expression of toll-like receptors in the pancreas of recent-onset fulminant type 1 diabetes.
19966777 2009 Commensal bacteria regulate Toll-like receptor 3-dependent inflammation after skin injury.
19966137 2010 ELMOD2, a candidate gene for idiopathic pulmonary fibrosis, regulates antiviral responses.
19951172 2009 Toll-like receptor 3 has no critical role during early immune response of human monocyte-derived dendritic cells after infection with the human cytomegalovirus strain TB40E.
19948350 2010 TLR3-dependent upregulation of RIG-I leads to enhanced cytokine production from cells infected with the parainfluenza virus SV5.
19914718 2010 Scavenger receptor A1 is required for sensing HCMV by endosomal TLR-3/-9 in monocytic THP-1 cells.
19902255 2010 Rubella vaccine-induced cellular immunity: evidence of associations with polymorphisms in the Toll-like, vitamin A and D receptors, and innate immune response genes.
19890046 2009 Role of double-stranded RNA pattern recognition receptors in rhinovirus-induced airway epithelial cell responses.
19887600 2009 Toll-like receptors 3 and 7 agonists enhance tumor cell lysis by human gammadelta T cells.
19878930 2010 Toll-like receptor 3 is involved in airway epithelial cell response to nontypeable Haemophilus influenzae.
19855253 2009 Polymorphisms in toll-like receptor 4 and toll-like receptor 9 influence viral load in a seroincident cohort of HIV-1-infected individuals.
19833099 2009 Impaired TLR3/IFN-beta signaling in monocyte-derived dendritic cells from patients with acute-on-chronic hepatitis B liver failure: relevance to the severity of liver damage.
19810822 2009 Single-nucleotide polymorphisms in genes encoding toll-like receptor -2, -3, -4, and -9 in case-control study with breast cancer.
19795416 2009 Oligomerized TICAM-1 (TRIF) in the cytoplasm recruits nuclear BS69 to enhance NF-kappaB activation and type I IFN induction.
19779021 2009 TLR3-mediated NF-{kappa}B signaling in human esophageal epithelial cells.
19769802 Cigarette smoke extract enhances rhinovirus-induced toll-like receptor 3 expression and interleukin-8 secretion in A549 cells.
19758322 2010 Activation of toll-like receptors 2, 3 or 5 induces matrix metalloproteinase-1 and -9 expression with the involvement of MAPKs and NF-kappaB in human epidermal keratinocytes.
19752565 2010 TLR3 in human eosinophils: functional effects and decreased expression during allergic rhinitis.
19748983 2009 TLR3 ligand polyinosinic:polycytidylic acid induces IL-17A and IL-21 synthesis in human Th cells.
19741468 2009 Impact of polymorphisms of TLR4/CD14 and TLR3 on acute rejection in kidney transplantation.
19740627 2009 Cultured human melanocytes express functional toll-like receptors 2-4, 7 and 9.
19656899 2009 Baculovirus transduction of mesenchymal stem cells triggers the toll-like receptor 3 pathway.
19646728 2009 TLR3 and TLR4 are innate antiviral immune receptors in human microglia: role of IRF3 in modulating antiviral and inflammatory response in the CNS.
19631980 2009 Toll-like receptor-3 stimulation upregulates sFLT-1 production by trophoblast cells.
19628747 2009 Toll-like receptor polymorphisms and age-related macular degeneration: replication in three case-control samples.
19625408 2009 Toll-like receptor 3 mediates establishment of an antiviral state against hepatitis C virus in hepatoma cells.
19597128 2010 Oxidative stress enhances toll-like receptor 3 response to double-stranded RNA in airway epithelial cells.
19593445 2009 Expression of the Bcl-2 protein BAD promotes prostate cancer growth.
19542247 2009 TLR3 activation stimulates cytokine secretion without altering agonist-induced human small airway contraction or relaxation.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19522763 2009 Functionally active toll-like receptor 3 on human primary and metastatic cancer cells.
19505919 2009 Toll-like receptor signaling pathway variants and prostate cancer mortality.
19494321 2009 Cytokine modulation of TLR expression and activation in mesenchymal stromal cells leads to a proinflammatory phenotype.
19475618 2009 TLR3 gene polymorphisms and liver disease manifestations in chronic hepatitis C.
19437550 2009 Activation of Toll-like receptors inhibits herpes simplex virus-1 infection of human neuronal cells.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19378782 2009 [Role of Toll-like receptors in innate and adaptive immune responses].
19362356 2009 Toll-like receptor 3 enhances late-phase reaction of experimental allergic conjunctivitis.
19299748 2009 TLR3 ligand induces NF-{kappa}B activation and various fates of multiple myeloma cells depending on IFN-{alpha} production.
19265130 2009 RhoA GTPase activation by TLR2 and TLR3 ligands: connecting via Src to NF-kappa B.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19254290 2009 Polymorphisms in interleukin-1 receptor-associated kinase 4 are associated with total serum IgE.
19247444 2009 Toll-like receptor 3 (TLR3) plays a major role in the formation of rabies virus Negri Bodies.
19234180 2009 Hantaan virus triggers TLR3-dependent innate immune responses.
19231996 2009 Localization of type I interferon receptor limits interferon-induced TLR3 in epithelial cells.
19164128 2009 Multiple signaling pathways contribute to synergistic TLR ligand-dependent cytokine gene expression in human monocyte-derived macrophages and dendritic cells.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19134117 2009 Human TLR3 recognizes dengue virus and modulates viral replication in vitro.
19120481 2009 Crosstalk between components of the innate immune system: promoting anti-microbial defenses and avoiding immunopathologies.
19055649 2009 Human TSLP and TLR3 ligands promote differentiation of Th17 cells with a central memory phenotype under Th2-polarizing conditions.
19035519 2008 Overexpression of toll-like receptors 3 and 4 in synovial tissue from patients with early rheumatoid arthritis: toll-like receptor expression in early and longstanding arthritis.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19016379 2008 Association of toll-like receptor 3 gene polymorphism with subacute sclerosing panencephalitis.
19001446 2008 Activation of Toll-like receptors 2, 3, and 4 on human melanoma cells induces inflammatory factors.
18988918 2009 Activation of Toll-like receptor 3 augments myofibroblast differentiation.
18978302 2009 Rhinovirus-induced major airway mucin production involves a novel TLR3-EGFR-dependent pathway.
18949355 2008 Dual topology of functional Toll-like receptor 3 expression in human hepatocellular carcinoma: differential signaling mechanisms of TLR3-induced NF-kappaB activation and apoptosis.
18946062 2008 Toll-like receptor 4 polymorphisms and aspergillosis in stem-cell transplantation.
18849495 2008 Deleterious role of TLR3 during hyperoxia-induced acute lung injury.
18832709 2008 The clathrin-mediated endocytic pathway participates in dsRNA-induced IFN-beta production.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18813073 2008 Innate immunity of the ocular surface and ocular surface inflammatory disorders.
18810425 2008 Natural selection in the TLR-related genes in the course of primate evolution.
18779317 2008 p53 regulates Toll-like receptor 3 expression and function in human epithelial cell lines.
18776592 2008 Polymorphisms of toll like receptors in the genetics of severe RSV associated diseases.
18776324 2008 Significance of the N-terminal histidine-rich region for the function of the human toll-like receptor 3 ectodomain.
18775079 2008 TLR3 and TLR4 expression in healthy and diseased human endometrium.
18753640 2008 Toll-like receptor 3 and geographic atrophy in age-related macular degeneration.
18725521 2008 Stimulation of Toll-like receptor 3 and 4 induces interleukin-1beta maturation by caspase-8.
18715647 2008 Developmental and epigenetic regulation of the human TLR3 gene.
18686608 2008 [Expression of toll-like receptors in human epidermal keratinocytes].
18684960 2008 Double-stranded RNA induces an antiviral defense status in epidermal keratinocytes through TLR3-, PKR-, and MDA5/RIG-I-mediated differential signaling.
18568036 2008 A second binding site for double-stranded RNA in TLR3 and consequences for interferon activation.
18566393 2008 Viral double-stranded RNA triggers Ig class switching by activating upper respiratory mucosa B cells through an innate TLR3 pathway involving BAFF.
18566014 2008 Toll-like receptor 3 triggers apoptosis of human prostate cancer cells through a PKC-alpha-dependent mechanism.
18562533 2008 West Nile virus nonstructural protein 1 inhibits TLR3 signal transduction.
18544529 2008 Modulation of double-stranded RNA recognition by the N-terminal histidine-rich region of the human toll-like receptor 3.
18541719 2008 Inhibition of TLR3 and TLR4 function and expression in human dendritic cells by helminth parasites.
18508883 2008 Dysregulation of TLR3 impairs the innate immune response to West Nile virus in the elderly.
18442983 2008 Cytomegalovirus M45 cell death suppression requires receptor-interacting protein (RIP) homotypic interaction motif (RHIM)-dependent interaction with RIP1.
18437017 2008 Expression of Toll-like receptors in verruca and molluscum contagiosum.
18394314 Toll-like receptors.
18385087 2008 Toll-like receptor polymorphisms and age-related macular degeneration.
18367536 2008 Upregulation of the TLR3 pathway by Kaposi's sarcoma-associated herpesvirus during primary infection.
18325643 2008 Associations between SNPs in toll-like receptors and related intracellular signaling molecules and immune responses to measles vaccine: preliminary results.
18262679 2008 TLR3: interferon induction by double-stranded RNA including poly(I:C).
18253710 2008 TLR-mediated induction of negative regulatory ligands on dendritic cells.
18204787 2008 Induction of c-Myc-dependent cell proliferation through toll-like receptor 3 in head and neck cancer.
18172197 2008 The TLR3 signaling complex forms by cooperative receptor dimerization.
18029758 2007 N-terminal binding site in the human toll-like receptor 3 ectodomain.
18021446 2007 Differential expression of viral PAMP receptors mRNA in peripheral blood of patients with chronic hepatitis C infection.
17982077 2007 Spatiotemporal mobilization of Toll/IL-1 receptor domain-containing adaptor molecule-1 in response to dsRNA.
17964520 2007 Genetic polymorphisms of viral infection-associated Toll-like receptors in Chinese population.
17963596 2007 [Expression of Toll-like receptor 3 on peripheral blood dendritic cells in HBeAg positive patients with chronic hepatitis B].
17962701 2008 Toll-like receptors 3 and 4 are expressed by human bone marrow-derived mesenchymal stem cells and can inhibit their T-cell modulatory activity by impairing Notch signaling.
17962643 2007 Heterogeneity of TLR3 mRNA transcripts and responsiveness to poly (I:C) in human NK cells derived from different donors.
17947455 2007 Expression of IL-12-related molecules in human intestinal microvascular endothelial cells is regulated by TLR3.
17939877 2007 Genetic polymorphisms of TLR3 are associated with Nasopharyngeal carcinoma risk in Cantonese population.
17908959 2007 Identification of Toll-like receptor 3 as a potential therapeutic target in clear cell renal cell carcinoma.
17897319 2007 Integral and associated lysosomal membrane proteins.
17872438 2007 TLR3 deficiency in patients with herpes simplex encephalitis.
17851256 2008 Ligation of Toll-like receptor 3 differentially regulates M2 and M3 muscarinic receptor expression and function in human airway smooth muscle cells.
17805015 2007 Th1 polarization of CD4+ T cells by Toll-like receptor 3-activated human microglia.
17786279 2007 Head and neck cancer triggers the internalization of TLR3 in natural killer cells.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17660379 2007 Key differences in TLR3/poly I:C signaling and cytokine induction by human primary cells: a phenomenon absent from murine cell systems.
17626075 2007 Astrocyte indoleamine 2,3-dioxygenase is induced by the TLR3 ligand poly(I:C): mechanism of induction and role in antiviral response.
17602875 2007 Involvement of Toll-like receptors in the immune response of nasal polyp epithelial cells.
17573354 2007 Polyinosinic acid is a ligand for toll-like receptor 3.
17534115 2007 Distinct functions between toll-like receptors 3 and 9 in retinal pigment epithelial cells.
17525119 2007 High basal levels of functional toll-like receptor 3 (TLR3) and noncanonical Wnt5a are expressed in papillary thyroid cancer and are coordinately decreased by phenylmethimazole together with cell proliferation and migration.
17521732 2007 C-terminal LRRs of human Toll-like receptor 3 control receptor dimerization and signal transmission.
17449641 2007 Double-stranded RNA induces galectin-9 in vascular endothelial cells: involvement of TLR3, PI3K, and IRF3 pathway.
17434873 2007 Effects of single nucleotide polymorphisms on Toll-like receptor 3 activity and expression in cultured cells.
17314152 2007 Toll-like receptor 3 gene polymorphisms in Japanese patients with Stevens-Johnson syndrome.
17301562 2007 Polymorphisms in Toll-like receptor 9 influence the clinical course of HIV-1 infection.
17292969 2007 Expression of toll-like receptors 2, 3, 4, and 9 genes in the human endometrium during the menstrual cycle.
17254392 2006 The molecular structure of the TLR3 extracellular domain.
17209042 2007 Biochemical and functional analyses of the human Toll-like receptor 3 ectodomain.
17178723 2007 Two tyrosine residues of Toll-like receptor 3 trigger different steps of NF-kappa B activation.
17150911 2006 Analysis of the interaction between human TLR3 ectodomain and nucleic acids.
17142772 2006 Human effector CD8+ T lymphocytes express TLR3 as a functional coreceptor.
17142768 2006 NAK-associated protein 1 participates in both the TLR3 and the cytoplasmic pathways in type I IFN induction.
17128265 2006 Maintenance of colonic homeostasis by distinctive apical TLR9 signalling in intestinal epithelial cells.
17085778 2006 The innate immune facet of brain: human neurons express TLR-3 and sense viral dsRNA.
17043099 2007 Human oviductal epithelial cells express Toll-like receptor 3 and respond to double-stranded RNA: Fallopian tube-specific mucosal immunity against viral infection.
16950283 2006 Toll-like receptor 2, 3, and 4 expression and function in human airway smooth muscle.
16935934 2006 Cooperative molecular and cellular networks regulate Toll-like receptor-dependent inflammatory responses.
16914605 2006 H. influenzae potentiates airway epithelial cell responses to rhinovirus by increasing ICAM-1 and TLR3 expression.
16877304 2006 Expression of Toll-like receptor 3 in the human cerebellar cortex in rabies, herpes simplex encephalitis, and other neurological diseases.
16858407 2006 Toll-like receptor 3 associates with c-Src tyrosine kinase on endosomes to initiate antiviral signaling.
16847112 2006 Herpes simplex virus 1 (HSV-1) DNA and immune complex (HSV-1-human IgG) elicit vigorous interleukin 6 release from infected corneal cells via Toll-like receptors.
16720699 2006 The dsRNA binding site of human Toll-like receptor 3.
16628196 2006 SOCS1-negative feedback of STAT1 activation is a key pathway in the dsRNA-induced innate immune response of human keratinocytes.
16585585 2006 TLR3 can directly trigger apoptosis in human cancer cells.
16533755 2006 Structural and functional analyses of the human Toll-like receptor 3. Role of glycosylation.
16484229 2006 IRF-8/interferon (IFN) consensus sequence-binding protein is involved in Toll-like receptor (TLR) signaling and contributes to the cross-talk between TLR and IFN-gamma signaling pathways.
16482523 2006 Toll-like receptor 3 on adult human astrocytes triggers production of neuroprotective mediators.
16473828 2006 Double-stranded RNA-mediated TLR3 activation is enhanced by CD14.
16424203 2006 Respiratory syncytial virus induces TLR3 protein and protein kinase R, leading to increased double-stranded RNA responsiveness in airway epithelial cells.
16399790 2006 Diesel exhaust enhances virus- and poly(I:C)-induced Toll-like receptor 3 expression and signaling in respiratory epithelial cells.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16293707 2006 Expression of toll-like receptors by human muscle cells in vitro and in vivo: TLR3 is highly expressed in inflammatory and HIV myopathies, mediates IL-8 release and up-regulation of NKG2D-ligands.
16289658 2006 Leukemia virus long terminal repeat activates NFkappaB pathway by a TLR3-dependent mechanism.
16286015 2005 Human TLR-7-, -8-, and -9-mediated induction of IFN-alpha/beta and -lambda Is IRAK-4 dependent and redundant for protective immunity to viruses.
16160153 2005 Toll-like receptor 3 is induced by and mediates antiviral activity against rhinovirus infection of human bronchial epithelial cells.
16146574 2005 Up-regulation of Toll-like receptors 2, 3 and 4 in allergic rhinitis.
16144834 2005 Recognition of double-stranded RNA by human toll-like receptor 3 and downstream receptor signaling requires multimerization and an acidic pH.
16111635 2005 Suppression of RNA recognition by Toll-like receptors: the impact of nucleoside modification and the evolutionary origin of RNA.
16043704 2005 The molecular structure of the Toll-like receptor 3 ligand-binding domain.
16035096 2005 Biliary epithelial cell antibodies induce expression of toll-like receptors 2 and 3: a mechanism for post-liver transplantation cholangitis?
16029432 2005 Toll-like receptor 3 gene polymorphisms in South African Blacks with type 1 diabetes.
15972671 2005 Regulation of the polymeric Ig receptor by signaling through TLRs 3 and 4: linking innate and adaptive immune responses.
15961631 2005 Crystal structure of human toll-like receptor 3 (TLR3) ectodomain.
15935884 2005 Human endometrial epithelial cells cyclically express Toll-like receptor 3 (TLR3) and exhibit TLR3-dependent responses to dsRNA.
15845391 2005 Triggering of TLR3 by polyI:C in human corneal epithelial cells to induce inflammatory cytokines.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15778392 2005 IFN-alpha enhances TLR3-mediated antiviral cytokine expression in human endothelial and epithelial cells by up-regulating TLR3 expression.
15767394 2005 Analysis of genes induced by Sendai virus infection of mutant cell lines reveals essential roles of interferon regulatory factor 3, NF-kappaB, and interferon but not toll-like receptor 3.
15737993 2005 Distinct poly(I-C) and virus-activated signaling pathways leading to interferon-beta production in hepatocytes.
15731229 2005 Differential role for TLR3 in respiratory syncytial virus-induced chemokine expression.
15652398 2005 Preferential expression and function of Toll-like receptor 3 in human astrocytes.
15579900 2005 Involvement of toll-like receptor 3 in the immune response of lung epithelial cells to double-stranded RNA and influenza A virus.
15502848 2004 Novel roles of TLR3 tyrosine phosphorylation and PI3 kinase in double-stranded RNA signaling.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15356140 2004 Microglia initiate central nervous system innate and adaptive immune responses through multiple TLRs.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15315972 2004 p38 MAPK activation controls the TLR3-mediated up-regulation of cytotoxicity and cytokine production in human NK cells.
15226270 2004 The cytoplasmic 'linker region' in Toll-like receptor 3 controls receptor localization and signaling.
15212709 2004 Ectopic expression of toll-like receptor-3 (TLR-3) overcomes the double-stranded RNA (dsRNA) signaling defects of P2.1 cells.
15153468 2004 Small interfering RNAs mediate sequence-independent gene suppression and induce immune activation by signaling through toll-like receptor 3.
15119015 2004 Cloning of TLR3 isoform.
15107846 2004 Triad3A, an E3 ubiquitin-protein ligase regulating Toll-like receptors.
15064760 2004 RIP1 is an essential mediator of Toll-like receptor 3-induced NF-kappa B activation.
14987294 2004 An association study of asthma and total serum immunoglobin E levels for Toll-like receptor polymorphisms in a Japanese population.
14982987 2004 Toll-like receptor 3-mediated activation of NF-kappaB and IRF3 diverges at Toll-IL-1 receptor domain-containing adapter inducing IFN-beta.
14729660 2004 mRNA is an endogenous ligand for Toll-like receptor 3.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14575692 2003 Mechanism of up-regulation of human Toll-like receptor 3 secondary to infection of measles virus-attenuated strains.
14557267 2003 Interferon regulatory factor-3-mediated activation of the interferon-sensitive response element by Toll-like receptor (TLR) 4 but not TLR3 requires the p65 subunit of NF-kappa.
14519765 2003 TIR-containing adapter molecule (TICAM)-2, a bridging adapter recruiting to toll-like receptor 4 TICAM-1 that induces interferon-beta.
12855817 2003 Role of adaptor TRIF in the MyD88-independent toll-like receptor signaling pathway.
12692549 2003 IKKepsilon and TBK1 are essential components of the IRF3 signaling pathway.
12672806 2003 Species-specific regulation of Toll-like receptor 3 genes in men and mice.
12646618 2003 Toll-like receptor 3 mediates a more potent antiviral response than Toll-like receptor 4.
12609980 2003 Poly(I-C)-induced Toll-like receptor 3 (TLR3)-mediated activation of NFkappa B and MAP kinase is through an interleukin-1 receptor-associated kinase (IRAK)-independent pathway employing the signaling components TLR3-TRAF6-TAK1-TAB2-PKR .
12539043 2003 TICAM-1, an adaptor molecule that participates in Toll-like receptor 3-mediated interferon-beta induction.
12509442 2003 Double-stranded RNA signaling by Toll-like receptor 3 requires specific tyrosine residues in its cytoplasmic domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471095 2002 Cutting edge: a novel Toll/IL-1 receptor domain-containing adapter that preferentially activates the IFN-beta promoter in the Toll-like receptor signaling.
12133979 2002 Stimulation by toll-like receptors inhibits osteoclast differentiation.
12054664 2002 Establishment of a monoclonal antibody against human Toll-like receptor 3 that blocks double-stranded RNA-mediated signaling.
11782555 2002 Toll-like receptors.
11607032 2001 Recognition of double-stranded RNA and activation of NF-kappaB by Toll-like receptor 3.
11561001 2001 Subsets of human dendritic cell precursors express different toll-like receptors and respond to different microbial antigens.
10820283 2000 Differential expression and regulation of toll-like receptors (TLR) in human leukocytes: selective expression of TLR3 in dendritic cells.
10426995 1999 Host defense mechanisms triggered by microbial lipoproteins through toll-like receptors.
10066798 1999 pp60(v-src) induction of cyclin D1 requires collaborative interactions between the extracellular signal-regulated kinase, p38, and Jun kinase pathways. A role for cAMP response element-binding protein and activating transcription factor-2 in pp60(v-src) signaling in breast cancer cells.
9435236 1998 A family of human receptors structurally related to Drosophila Toll.