Property Summary

NCBI Gene PubMed Count 82
PubMed Score 56.14
PubTator Score 61.57

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -1.314 1.3e-05
interstitial cystitis 2.300 7.3e-03
pediatric high grade glioma 1.200 2.8e-05
group 3 medulloblastoma -1.100 1.6e-02
pilocytic astrocytoma 1.300 3.6e-05
ulcerative colitis 1.400 3.2e-03
psoriasis 1.100 2.0e-15

Protein-protein Interaction (5)

Gene RIF (71)

PMID Text
26559190 concluded that TLR-1 rs4833095 and TLR10 rs10004195 confer susceptibility to development of gastroduodenal disease, especially GC in H.pylori disease
26364993 Data indicate that polymorphisms in toll like receptor 10 (TLR10) are not associated with chronic Q fever.
26312625 Study annotated variants at 4p14 as expression quantitative trait loci (eQTL) associated with TLR6/10 and FAM114A1; findings suggest that 4p14 polymorphisms are linked to host immune response to H. pylori infection but not to its acquisition.
25895985 genetic variants in TLR10 are associated with protection against complicated skin and skin structure infections
25857634 single nucleotide polymorphism (SNP) in TLR10 (rs11096957) is associated with risk for Tuberculosis
25850295 The correlation between TLR1, TLR6, and TLR10 polymorphisms and the development of atopic dermatitis in the Republic of Bashkortostan has been found.
25687912 TLR1 rs4833095 and TLR10 rs10004195 may play crucial roles in H. pylori susceptibility and gastric pathogenesis.
25295614 Our results suggest that TLR10 polymorphisms may contribute to the pathogenesis of autoimmune thyroid diseases.
25288745 TLR10 is a modulatory pattern-recognition receptor with mainly inhibitory properties
25028161 Genetic variation rs5743565 in TLR1 might be associated with the decreased susceptibility to Graves disease, whlie polymorphisms in TLR6 and TLR10 did not reach the statistical significance.
24712925 The results suggest roles for TLR3, TLR10, PLAT (n=2), VEGFA and DENND1B in susceptibility to chronic cavitary pulmonary aspergillosis.
24567377 Toll-like receptor 10 is involved in induction of innate immune responses to influenza virus infection.
24198280 CCL20, CCL1, & IL-8 were reduced following TKR10 knockdown. TLR10 silencing increased viability of L. monocytogenes in both HT-29 & THP-1 cells. TLR10 senses pathogenic infection in both intestinal epithelium & macrophages.
24198280 data indicate novel roles for TLR10 in sensing pathogenic infection in both the epithelium and macrophages and have identified L. monocytogenes as a source of ligand for the orphan receptor TLR10.
23370977 Allelic variants in TLR10 gene is associated with bilateral affectation and clinical course of Meniere's disease.
23279063 promotes trophoblast apoptosis triggered by gram-positive bacterial components
23151486 The study shows that genetic variation within the TLR10/1/6 locus is the major common genetic factor explaining interindividual variation in TLR1/2-mediated cytokine responses.
23124277 genetic association study in a population in Republic of Korea: Data suggest that SNP in TLR10 (rs11466653; T allele, Met326Thr) is associated with development of papillary thyroid carcinoma with small tumor size (<1 cm).
22703024 The results showed that the genetic markers in TLR1, TLR4, TLR5 TLR6, and TLR10 were associated with the occurrence of acute Graft-versus-host disease following hematopoietic stem cell transplantation
22504414 Statistical differences have been found in TLR10 (rs4129009) gene between low and high tumor infiltration stage.
22342453 genetic variation in TLR10 plays a role in interindividual differences in CD susceptibility and clinical outcome.
22150367 absence of the common haplotype in the TLR10-TLR1-TLR6 gene cluster increases the risk of developing chronic disease in patients already affected by sarcoidosis.
21716313 Our results support association of the TLR10 gene with CD susceptibility. The effect of TLR10 would be independent of NOD2, suggesting different signaling pathways for both genes.
21499082 Quantitative polymerase chain reaction showed significantly higher expression of LEAP-1 (P = 0.002) and TLR-8 (P = 0.023) and TLR-10 (P = 0.014) in viral keratitis and LEAP-2 (P = 0.034) in dry eye, versus controls.
20977567 Observational study of gene-disease association. (HuGE Navigator)
20953797 Case-control analysis showed that the TLR10 gene single nucleotide polymorphism rs10004195 was associated with immunoglobulin A nephropathy (IgAN) in Korean children. Results suggest that TLR10 gene may be associated with susceptibility to IgAN.
20953797 Observational study of gene-disease association. (HuGE Navigator)
20877634 Pam(3)CSK(4) is the ligand for the hTLR10/2 complex and PamCysPamSK4 activates hTLR10/1 hetero and hTLR10 homodimer.
20815312 genetic polymorphism association with allergic rhinitis in asthma in a Chinese population
20815312 Observational study of gene-disease association. (HuGE Navigator)
20800603 Observational study of gene-disease association. (HuGE Navigator)
20595247 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20568250 Observational study of gene-disease association. (HuGE Navigator)
20503287 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20444155 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20422193 No significant differences are found in the TLR3 and TLR10 genotypes or allele distribution between rheumatoid arthritis patients and control individuals.
20422193 Observational study of gene-disease association. (HuGE Navigator)
20406964 Observational study of gene-disease association. (HuGE Navigator)
20348427 Analysis of chimeric receptors containing the TLR10 extracellular recognition domain indicates that human TLR10 cooperates with TLR2 in sensing of microbes and fungi but possesses a signaling function distinct from that of other TLR2 subfamily members.
20237496 Observational study of gene-disease association. (HuGE Navigator)
20227302 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
19573080 Observational study of gene-disease association. (HuGE Navigator)
19505919 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19406482 in reproductive tract, expression is restricted to Fallopian tube
19332998 IL-13/IL-4 and TLR-10 might be involved in the genetics of preterm births.
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19254290 Observational study of gene-disease association. (HuGE Navigator)
19247692 Observational study of gene-disease association. (HuGE Navigator)
19029192 Meta-analysis of gene-disease association. (HuGE Navigator)
18776592 Observational study of gene-disease association. (HuGE Navigator)
18752252 common haplotype in the TLR10-TLR1-TLR6 gene cluster influences prostate cancer risk and clearly supports the need for further investigation of TLR genes in other populations
18752252 Observational study of gene-disease association. (HuGE Navigator)
18686608 Human epidermal keratinocytes constitutively express all TLR 1-10 mRNA, which may enable human keratinocytes to respond to a wide range of pathogenic micro-organisms.
18547625 Observational study of gene-disease association. (HuGE Navigator)
18332149 The TLR10 structure is in good agreement with available biochemical data on TLR receptors and is likely to provide a good model for the physiological dimer.
18091991 Observational study of gene-disease association. (HuGE Navigator)
17932345 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
17932345 We genotyped 19 common (>5%) haplotype-tagging SNPs chosen from the SNPs discovered in a resequencing study spanning TLR6, TLR1, and TLR10 to test for the association between sequence variants cluster and prostate cancer.
17703412 Observational study of gene-disease association. (HuGE Navigator)
16702361 Observational study of gene-disease association. (HuGE Navigator)
16537705 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15812078 Observational study of gene-disease association. (HuGE Navigator)
15812078 The observed multiple associated SNPs at the TLR6-TLR1-TLR10 gene cluster were dependent and suggest the presence of a founder prostate cancer risk variant on this haplotype background.
15728506 Unlike TLR1 and TLR6, TLR10 is expressed in a highly restricted fashion as a highly N-glycosylated protein, which is detected in B cell lines, B cells from peripheral blood, and plasmacytoid dendritic cells from tonsil.
15201134 Observational study of gene-disease association. (HuGE Navigator)
15201134 TLR10 is a potential asthma candidate gene. TLR10 genetic variation contributes to asthma risk.
12689944 normal and neoplastic human B lymphocytes express a distinct TLR repertoire including TLR9 and TLR10 and expression is increased upon engagement of the antigen receptor complex or TLR9 itself

AA Sequence

MRLIRNIYIFCSIVMTAEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLLFQLQSSDFHS      1 - 70
VSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLRYLDLSFNDFDTMPICEEAGN     71 - 140
MSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHYEEGSLPILNTTKLHIVLPMDTNFWVLLRDG    141 - 210
IKTSKILEMTNIDGKSQFVSYEMQRNLSLENAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVT    211 - 280
FGGKAYLDHNSFDYSNTVMRTIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKF    281 - 350
QYLNFANNILTDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP    351 - 420
ETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTDLPGCSHFSRL    421 - 490
SVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYSEVMMVGWSDSYTCEYPLNLR    491 - 560
GTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLHFDLPWYLRMLGQCTQTWHRVRKTTQEQLKR    561 - 630
NVRFHAFISYSEHDSLWVKNELIPNLEKEDGSILICLYESYFDPGKSISENIVSFIEKSYKSIFVLSPNF    631 - 700
VQNEWCHYEFYFAHHNLFHENSDHIILILLEPIPFYCIPTRYHKLKALLEKKAYLEWPKDRRKCGLFWAN    701 - 770
LRAAINVNVLATREMYELQTFTELNEESRGSTISLMRTDCL                                 771 - 811
//

Text Mined References (83)

PMID Year Title
26559190 2015 Polymorphisms at Locus 4p14 of Toll-Like Receptors TLR-1 and TLR-10 Confer Susceptibility to Gastric Carcinoma in Helicobacter pylori Infection.
26364993 2016 Genetic variation in TLR10 is not associated with chronic Q fever, despite the inhibitory effect of TLR10 on Coxiella burnetii-induced cytokines in vitro.
26312625 2015 Association of 4p14 TLR locus with antibodies to Helicobacter pylori.
25895985 2015 Genetic Variation in TLR10, an Inhibitory Toll-Like Receptor, Influences Susceptibility to Complicated Skin and Skin Structure Infections.
25857634 2015 Genetic Polymorphisms in the Toll-like Receptor 10, Interleukin (IL)17A and IL17F Genes Differently Affect the Risk for Tuberculosis in Croatian Population.
25850295 [Association of polymorphisms in toll-like receptor genes with atopic dermatitis in the Republic of Bashkortostan].
25687912 2015 Toll-like receptor 1 and 10 polymorphisms, Helicobacter pylori susceptibility and risk of gastric lesions in a high-risk Chinese population.
25295614 2015 Association of Toll-like receptor 10 polymorphisms with autoimmune thyroid disease in Korean children.
25288745 2014 Human TLR10 is an anti-inflammatory pattern-recognition receptor.
25028161 2015 Polymorphisms in TLR1, TLR6 and TLR10 genes and the risk of Graves' disease.
24712925 2014 Reduced expression of TLR3, TLR10 and TREM1 by human macrophages in Chronic cavitary pulmonary aspergillosis, and novel associations of VEGFA, DENND1B and PLAT.
24567377 2014 Toll-like receptor 10 is involved in induction of innate immune responses to influenza virus infection.
24198280 2013 Identification of TLR10 as a key mediator of the inflammatory response to Listeria monocytogenes in intestinal epithelial cells and macrophages.
23817571 2013 Meta-analysis of genome-wide association studies identifies ten loci influencing allergic sensitization.
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23652523 2013 Identification of genetic loci associated with Helicobacter pylori serologic status.
23370977 2013 Allelic variants in TLR10 gene may influence bilateral affectation and clinical course of Meniere's disease.
23279063 2013 Cutting-edge report: TLR10 plays a role in mediating bacterial peptidoglycan-induced trophoblast apoptosis.
23151486 2013 Variation in the TLR10/TLR1/TLR6 locus is the major genetic determinant of interindividual difference in TLR1/2-mediated responses.
23124277 2013 A missense polymorphism (rs11466653, Met326Thr) of toll-like receptor 10 (TLR10) is associated with tumor size of papillary thyroid carcinoma in the Korean population.
22703024 2012 Toll-like receptor gene polymorphisms confer susceptibility to graft-versus-host disease in allogenic hematopoietic stem cell transplantation.
22504414 2012 Association between C13ORF31, NOD2, RIPK2 and TLR10 polymorphisms and urothelial bladder cancer.
22342453 2012 Genetic variation within TLR10 is associated with Crohn's disease in a New Zealand population.
22150367 2012 Genetic variation in the Toll-like receptor gene cluster (TLR10-TLR1-TLR6) influences disease course in sarcoidosis.
21716313 2011 Association of Toll-like receptor 10 and susceptibility to Crohn's disease independent of NOD2.
21499082 2011 Increased expression of hepcidin and toll-like receptors 8 and 10 in viral keratitis.
20977567 2011 Polymorphism in 3'-untranslated region of toll-like receptor 4 gene is associated with protection from hepatitis B virus recurrence after liver transplantation.
20953797 2011 Association between toll-like receptor 10 (TLR10) gene polymorphisms and childhood IgA nephropathy.
20877634 2010 Molecular modeling-based evaluation of hTLR10 and identification of potential ligands in Toll-like receptor signaling.
20815312 2010 Polymorphisms in the toll-like receptor 2 subfamily and risk of asthma: a case-control analysis in a Chinese population.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20595247 2010 Polymorphisms of innate pattern recognition receptors, response to interferon-beta and development of neutralizing antibodies in multiple sclerosis patients.
20568250 2010 Common single nucleotide polymorphisms in immunoregulatory genes and multiple myeloma risk among women in Connecticut.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20444155 2010 Joint influences of Acidic-Mammalian-Chitinase with Interleukin-4 and Toll-like receptor-10 with Interleukin-13 in the genetics of asthma.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20422193 2011 The investigation of toll-like receptor 3, 9 and 10 gene polymorphisms in Turkish rheumatoid arthritis patients.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20348427 2010 Human TLRs 10 and 1 share common mechanisms of innate immune sensing but not signaling.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20227302 2010 Polymorphisms in innate immunity genes associated with development of bronchiolitis obliterans after lung transplantation.
19924287 2009 The heterogeneous allelic repertoire of human toll-like receptor (TLR) genes.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
19573080 2009 Common genetic variants in candidate genes and risk of familial lymphoid malignancies.
19505919 2009 Toll-like receptor signaling pathway variants and prostate cancer mortality.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19406482 2009 Functional expression of pattern recognition receptors in tissues of the human female reproductive tract.
19332998 2009 Association of interleukin-13/-4 and toll-like receptor 10 with preterm births.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19254290 2009 Polymorphisms in interleukin-1 receptor-associated kinase 4 are associated with total serum IgE.
19247692 2009 Analyses of associations with asthma in four asthma population samples from Canada and Australia.
19029192 2009 A pooled investigation of Toll-like receptor gene variants and risk of non-Hodgkin lymphoma.
18810425 2008 Natural selection in the TLR-related genes in the course of primate evolution.
18776592 2008 Polymorphisms of toll like receptors in the genetics of severe RSV associated diseases.
18752252 2008 Genetic variation in the toll-like receptor gene cluster (TLR10-TLR1-TLR6) and prostate cancer risk.
18686608 2008 [Expression of toll-like receptors in human epidermal keratinocytes].
18547625 2008 Toll-like receptor heterodimer variants protect from childhood asthma.
18394314 Toll-like receptors.
18332149 2008 The crystal structure of the human toll-like receptor 10 cytoplasmic domain reveals a putative signaling dimer.
18091991 2007 Full-exon resequencing reveals toll-like receptor variants contribute to human susceptibility to tuberculosis disease.
17932345 2007 Association between Toll-like receptor gene cluster (TLR6, TLR1, and TLR10) and prostate cancer.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
16702361 2006 Sequence variants in toll-like receptor 10 are associated with nasopharyngeal carcinoma risk.
16537705 2006 Interactions of sequence variants in interleukin-1 receptor-associated kinase4 and the toll-like receptor 6-1-10 gene cluster increase prostate cancer risk.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16024789 2005 A novel splice variant of interleukin-1 receptor (IL-1R)-associated kinase 1 plays a negative regulatory role in Toll/IL-1R-induced inflammatory signaling.
15812078 2005 Sequence variants in Toll-like receptor gene cluster (TLR6-TLR1-TLR10) and prostate cancer risk.
15728506 2005 Human TLR10 is a functional receptor, expressed by B cells and plasmacytoid dendritic cells, which activates gene transcription through MyD88.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15201134 2004 TOLL-like receptor 10 genetic variation is associated with asthma in two independent samples.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14625308 2004 Sequential autophosphorylation steps in the interleukin-1 receptor-associated kinase-1 regulate its availability as an adapter in interleukin-1 signaling.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12689944 2003 The toll-like receptor repertoire of human B lymphocytes: inducible and selective expression of TLR9 and TLR10 in normal and transformed cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11970999 2002 Quantitative expression of toll-like receptor 1-10 mRNA in cellular subsets of human peripheral blood mononuclear cells and sensitivity to CpG oligodeoxynucleotides.
11782555 2002 Toll-like receptors.
11561001 2001 Subsets of human dendritic cell precursors express different toll-like receptors and respond to different microbial antigens.
11267672 2001 Identification of hTLR10: a novel human Toll-like receptor preferentially expressed in immune cells.
9435236 1998 A family of human receptors structurally related to Drosophila Toll.