Property Summary

NCBI Gene PubMed Count 28
PubMed Score 18.33
PubTator Score 17.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytic glioma -1.100 2.6e-03
ependymoma -2.500 4.5e-20
oligodendroglioma -1.400 1.1e-17
glioblastoma -2.000 3.2e-05
osteosarcoma -1.688 8.6e-04
medulloblastoma -2.700 9.8e-09
atypical teratoid / rhabdoid tumor -2.300 5.4e-07
medulloblastoma, large-cell -2.400 1.3e-04
primitive neuroectodermal tumor -2.300 1.6e-04
active Crohn's disease -1.166 7.0e-03
fibroadenoma -1.300 1.3e-02
pediatric high grade glioma -1.800 9.6e-07
pilocytic astrocytoma -1.800 3.4e-08
Pick disease -1.200 9.9e-03
ductal carcinoma in situ -2.000 9.6e-05
invasive ductal carcinoma -2.200 6.1e-04
pituitary cancer -1.900 5.1e-04

Gene RIF (14)

PMID Text
26822056 Both TLN-1 and TLN-2 levels correlate with tumorigenicity in human HCC, indicating that these molecules constitute important molecular targets for the diagnosis and/or treatment of hepatocellular carcinoma .
24446374 Data indicate the role of vinculin in inducing the talin mediated integrin activation.
23266827 Talin1 has unique expression versus talin 2 in the heart and modifies the hypertrophic response to pressure overload.
22017400 HIV-1 MA co-localizes with beta2 integrin, alphaM and alphaX integrins in the intracellular thick electron-dense membrane compartments, which contain talin, vinculin and paxillin that connect the integrin complexes to the actin cytoskeleton
21812955 Data show that SCGB3A1 was down-regulated in invasive compared with DCIS, whereas talin 2 (TLN2) and PTGS1 were up-regulated in invasive compared with DCIS.
21134644 Structural diversity in integrin/talin interactions.
20620133 the differential concentration of CSF and serum-talin 2 in the drug-refractory postencephalitic epilepsy group is an intractability-related phenomenon that might be involved in the development of RPEE
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19952892 This review discusses the general function of talin 1 and talin 2, as well as vinculin/metavinulin, with emphasis on what is understood about their role in the cardiac myocyte and in whole heart.
19109932 Data show that TLN2n presents only in the CSF of temporal lobe epilepsy patients.
17183545 Talin2 may serve as the link between integrins and the sarcomeric cytoskeletonin stable adhesion complexes in mature striated muscle.
15581353 The F-actin binding capacity of Talin 2 is regulated by intrasteric occlusion of primary actin-binding determinants within the talin I/LWEQ module.
12422219 we show that the predominant brain splice variant of PtdInsPKI gamma (PtdInsPKI gamma-90) binds, by means of a short carboxy-terminal peptide, to the FERM domain of talin, and is strongly activated by this interaction
12119179 HIV-1 MA co-localizes with beta2 integrin, alphaM and alphaX integrins in the intracellular thick electron-dense membrane compartments, which contain talin, vinculin and paxillin that connect the integrin complexes to the actin cytoskeleton

AA Sequence

MVALSLKICVRHCNVVKTMQFEPSTAVYDACRVIRERVPEAQTGQASDYGLFLSDEDPRKGIWLEAGRTL      1 - 70
DYYMLRNGDILEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQETIEEKK     71 - 140
EEGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETLLLRRKFFYSDQNVDSRD    141 - 210
PVQLNLLYVQARDDILNGSHPVSFEKACEFGGFQAQIQFGPHVEHKHKPGFLDLKEFLPKEYIKQRGAEK    211 - 280
RIFQEHKNCGEMSEIEAKVKYVKLARSLRTYGVSFFLVKEKMKGKNKLVPRLLGITKDSVMRVDEKTKEV    281 - 350
LQEWPLTTVKRWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES    351 - 420
TMLEESVSPKKSTILQQQFNRTGKAEHGSVALPAVMRSGSSGPETFNVGSMPSPQQQVMVGQMHRGHMPP    421 - 490
LTSAQQALMGTINTSMHAVQQAQDDLSELDSLPPLGQDMASRVWVQNKVDESKHEIHSQVDAITAGTASV    491 - 560
VNLTAGDPADTDYTAVGCAITTISSNLTEMSKGVKLLAALMDDEVGSGEDLLRAARTLAGAVSDLLKAVQ    561 - 630
PTSGEPRQTVLTAAGSIGQASGDLLRQIGENETDERFQDVLMSLAKAVANAAAMLVLKAKNVAQVAEDTV    631 - 700
LQNRVIAAATQCALSTSQLVACAKVVSPTISSPVCQEQLIEAGKLVDRSVENCVRACQAATTDSELLKQV    701 - 770
SAAASVVSQALHDLLQHVRQFASRGEPIGRYDQATDTIMCVTESIFSSMGDAGEMVRQARVLAQATSDLV    771 - 840
NAMRSDAEAEIDMENSKKLLAAAKLLADSTARMVEAAKGAAANPENEDQQQRLREAAEGLRVATNAAAQN    841 - 910
AIKKKIVNRLEVAAKQAAAAATQTIAASQNAAVSNKNPAAQQQLVQSCKAVADHIPQLVQGVRGSQAQAE    911 - 980
DLSAQLALIISSQNFLQPGSKMVSSAKAAVPTVSDQAAAMQLSQCAKNLATSLAELRTASQKAHEACGPM    981 - 1050
EIDSALNTVQTLKNELQDAKMAAVESQLKPLPGETLEKCAQDLGSTSKAVGSSMAQLLTCAAQGNEHYTG   1051 - 1120
VAARETAQALKTLAQAARGVAASTTDPAAAHAMLDSARDVMEGSAMLIQEAKQALIAPGDAERQQRLAQV   1121 - 1190
AKAVSHSLNNCVNCLPGQKDVDVALKSIGESSKKLLVDSLPPSTKPFQEAQSELNQAAADLNQSAGEVVH   1191 - 1260
ATRGQSGELAAASGKFSDDFDEFLDAGIEMAGQAQTKEDQIQVIGNLKNISMASSKLLLAAKSLSVDPGA   1261 - 1330
PNAKNLLAAAARAVTESINQLITLCTQQAPGQKECDNALRELETVKGMLDNPNEPVSDLSYFDCIESVME   1331 - 1400
NSKVLGESMAGISQNAKTGDLPAFGECVGIASKALCGLTEAAAQAAYLVGISDPNSQAGHQGLVDPIQFA   1401 - 1470
RANQAIQMACQNLVDPGSSPSQVLSAATIVAKHTSALCNACRIASSKTANPVAKRHFVQSAKEVANSTAN   1471 - 1540
LVKTIKALDGDFSEDNRNKCRIATAPLIEAVENLTAFASNPEFVSIPAQISSEGSQAQEPILVSAKTMLE   1541 - 1610
SSSYLIRTARSLAINPKDPPTWSVLAGHSHTVSDSIKSLITSIRDKAPGQRECDYSIDGINRCIRDIEQA   1611 - 1680
SLAAVSQSLATRDDISVEALQEQLTSVVQEIGHLIDPIATAARGEAAQLGHKVTQLASYFEPLILAAVGV   1681 - 1750
ASKILDHQQQMTVLDQTKTLAESALQMLYAAKEGGGNPKAQHTHDAITEAAQLMKEAVDDIMVTLNEAAS   1751 - 1820
EVGLVGGMVDAIAEAMSKLDEGTPPEPKGTFVDYQTTVVKYSKAIAVTAQEMMTKSVTNPEELGGLASQM   1821 - 1890
TSDYGHLAFQGQMAAATAEPEEIGFQIRTRVQDLGHGCIFLVQKAGALQVCPTDSYTKRELIECARAVTE   1891 - 1960
KVSLVLSALQAGNKGTQACITAATAVSGIIADLDTTIMFATAGTLNAENSETFADHRENILKTAKALVED   1961 - 2030
TKLLVSGAASTPDKLAQAAQSSAATITQLAEVVKLGAASLGSDDPETQVVLINAIKDVAKALSDLISATK   2031 - 2100
GAASKPVDDPSMYQLKGAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTVFQSKDVPEKT   2101 - 2170
SSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVSDMLTACKQASFHPDVSDEVRTRALRF   2171 - 2240
GTECTLGYLDLLEHVLVILQKPTPEFKQQLAAFSKRVAGAVTELIQAAEAMKGTEWVDPEDPTVIAETEL   2241 - 2310
LGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSI   2311 - 2380
PANAADDGQWSQGLISAARMVAAATSSLCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQD   2381 - 2450
SEAMRRLQAAGNAVKRASDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARK   2451 - 2520
KLAQIRQQQYKFLPTELREDEG                                                   2521 - 2542
//

Text Mined References (37)

PMID Year Title
27223613 2016 Exome Sequencing of a Pedigree Reveals S339L Mutation in the TLN2 Gene as a Cause of Fifth Finger Camptodactyly.
26822056 2016 Both Talin-1 and Talin-2 correlate with malignancy potential of the human hepatocellular carcinoma MHCC-97 L cell.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24446374 2014 Vinculin regulates assembly of talin: ?3 integrin complexes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23728906 2013 A genome-wide association study of sleep habits and insomnia.
23266827 2013 Talin1 has unique expression versus talin 2 in the heart and modifies the hypertrophic response to pressure overload.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21812955 2011 Serum estradiol levels associated with specific gene expression patterns in normal breast tissue and in breast carcinomas.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21134644 2010 Structural diversity in integrin/talin interactions.
20620133 2010 Talin 2 concentrations in cerebrospinal fluid in patients with epilepsy.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20197096 2010 Genome-wide analysis reveals novel genes influencing temporal lobe structure with relevance to neurodegeneration in Alzheimer's disease.
19952892 2009 Vinculin and talin: focus on the myocardium.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19234221 2009 c-Abl kinase is required for beta 2 integrin-mediated neutrophil adhesion.
19109932 2009 Proteomic analysis of cerebrospinal fluid from patients with idiopathic temporal lobe epilepsy.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17183545 2007 Talin2 is induced during striated muscle differentiation and is targeted to stable adhesion complexes in mature muscle.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15581353 2004 Intrasteric inhibition mediates the interaction of the I/LWEQ module proteins Talin1, Talin2, Hip1, and Hip12 with actin.
15494027 2004 Cytoskeletal proteins talin and vinculin in integrin-mediated adhesion.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
12422220 2002 Type I gamma phosphatidylinositol phosphate kinase targets and regulates focal adhesions.
12422219 2002 Recruitment and regulation of phosphatidylinositol phosphate kinase type 1 gamma by the FERM domain of talin.
12168954 2002 Construction of expression-ready cDNA clones for KIAA genes: manual curation of 330 KIAA cDNA clones.
11527381 2001 Analysis of the mammalian talin2 gene TLN2.
10320934 1999 Integrin-mediated cell adhesion: the cytoskeletal connection.
9205841 1997 Prediction of the coding sequences of unidentified human genes. VII. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.