Property Summary

NCBI Gene PubMed Count 15
PubMed Score 6.10
PubTator Score 5.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.500 7.4e-03
astrocytic glioma -1.800 1.3e-02
Astrocytoma, Pilocytic -2.100 7.6e-07
atypical teratoid / rhabdoid tumor 1.400 3.3e-03
ependymoma -2.100 1.6e-02
glioblastoma -1.600 6.7e-05
group 4 medulloblastoma -2.000 5.7e-04
intraductal papillary-mucinous neoplasm ... 1.400 1.4e-02
medulloblastoma, large-cell -2.800 1.7e-04
oligodendroglioma -1.900 1.2e-02
ovarian cancer 1.100 1.1e-06
primitive neuroectodermal tumor -1.500 4.5e-02

 MGI Phenotype (1)

 CSPA Cell Line (2)

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MPRATALGALVSLLLLLPLPRGAGGLGERPDATADYSELDGEEGTEQQLEHYHDPCKAAVFWGDIALDED      1 - 70
DLKLFHIDKARDWTKQTVGATGHSTGGLEEQASESSPDTTAMDTGTKEAGKDGRENTTLLHSPGTLHAAA     71 - 140
KTFSPRVRRATTSRTERIWPGGVIPYVIGGNFTGSQRAIFKQAMRHWEKHTCVTFIERTDEESFIVFSYR    141 - 210
TCGCCSYVGRRGGGPQAISIGKNCDKFGIVAHELGHVVGFWHEHTRPDRDQHVTIIRENIQPGQEYNFLK    211 - 280
MEAGEVSSLGETYDFDSIMHYARNTFSRGVFLDTILPRQDDNGVRPTIGQRVRLSQGDIAQARKLYKCPA    281 - 350
CGETLQDTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAP    351 - 420
LLGRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAAYEATCGGDMNKDAGQIQSPNYPDDYRPSKEC    421 - 490
VWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCGYEKPEDVKSSSNRLWMKFVS    491 - 560
DGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKCACDPGYELAADKKMCEVACGGFITKLNGT    561 - 630
ITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFVEVRSGLSPDAKLHGRFCGSETP    631 - 700
EVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHD    701 - 770
CKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGP    771 - 840
DSLAPILGRFCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTKELYSHAQFGD    841 - 910
NNYPSEARCDWVIVAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGYDSSAPRLGRFCGSGPLEEIYSAG    911 - 980
DSLMIRFRTDDTINKKGFHARYTSTKFQDALHMKK                                       981 - 1015
//

Text Mined References (15)

PMID Year Title