Property Summary

NCBI Gene PubMed Count 18
PubMed Score 12.09
PubTator Score 20.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
psoriasis -1.300 2.5e-07
cutaneous lupus erythematosus -1.400 2.1e-02
posterior fossa group A ependymoma -1.700 1.4e-05
group 4 medulloblastoma 2.800 2.7e-04
atypical teratoid / rhabdoid tumor -1.300 2.1e-02
acute quadriplegic myopathy -1.096 4.3e-06
adrenocortical carcinoma -1.060 1.9e-04
non-small cell lung cancer -1.183 2.4e-12
active Crohn's disease -1.143 7.3e-03
breast carcinoma -1.100 3.6e-04
interstitial cystitis -1.800 2.4e-03
pilocytic astrocytoma 1.200 3.0e-02
primary Sjogren syndrome -1.800 9.7e-03
subependymal giant cell astrocytoma -2.266 2.7e-02
non-inflammatory breast cancer -2.100 4.5e-03
ovarian cancer -1.400 7.9e-08

Protein-protein Interaction (11)

Gene RIF (1)

PMID Text
19939918 Immunofluorescence analysis showed that TLE2 and RTA were colocalized in the same nuclear compartment in KSHV-infected cells.

AA Sequence

MYPQGRHPTPLQSGQPFKFSILEICDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGL      1 - 70
NIEMHKQAEIVKRLSGICAQIIPFLTQEHQQQVLQAVERAKQVTVGELNSLIGQQLQPLSHHAPPVPLTP     71 - 140
RPAGLVGGSATGLLALSGALAAQAQLAAAVKEDRAGVEAEGSRVERAPSRSASPSPPESLVEEERPSGPG    141 - 210
GGGKQRADEKEPSGPYESDEDKSDYNLVVDEDQPSEPPSPATTPCGKVPICIPARRDLVDSPASLASSLG    211 - 280
SPLPRAKELILNDLPASTPASKSCDSSPPQDASTPGPSSASHLCQLAAKPAPSTDSVALRSPLTLSSPFT    281 - 350
TSFSLGSHSTLNGDLSVPSSYVSLHLSPQVSSSVVYGRSPVMAFESHPHLRGSSVSSSLPSIPGGKPAYS    351 - 420
FHVSADGQMQPVPFPSDALVGAGIPRHARQLHTLAHGEVVCAVTISGSTQHVYTGGKGCVKVWDVGQPGA    421 - 490
KTPVAQLDCLNRDNYIRSCKLLPDGRSLIVGGEASTLSIWDLAAPTPRIKAELTSSAPACYALAVSPDAK    491 - 560
VCFSCCSDGNIVVWDLQNQTMVRQFQGHTDGASCIDISDYGTRLWTGGLDNTVRCWDLREGRQLQQHDFS    561 - 630
SQIFSLGHCPNQDWLAVGMESSNVEILHVRKPEKYQLHLHESCVLSLKFASCGRWFVSTGKDNLLNAWRT    631 - 700
PYGASIFQSKESSSVLSCDISRNNKYIVTGSGDKKATVYEVVY                               701 - 743
//

Text Mined References (22)

PMID Year Title
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
22304967 2012 XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling.
19939918 2010 Cellular corepressor TLE2 inhibits replication-and-transcription- activator-mediated transactivation and lytic reactivation of Kaposi's sarcoma-associated herpesvirus.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19460168 2009 Groucho binds two conserved regions of LEF-1 for HDAC-dependent repression.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18254933 2008 The Groucho/TLE/Grg family of transcriptional co-repressors.
17041588 2006 CUL4-DDB1 ubiquitin ligase interacts with multiple WD40-repeat proteins and regulates histone methylation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11748221 2002 HMGB1 interacts with many apparently unrelated proteins by recognizing short amino acid sequences.
11266540 2001 All Tcf HMG box transcription factors interact with Groucho-related co-repressors.
10825294 2000 Groucho/TLE/R-esp proteins associate with the nuclear matrix and repress RUNX (CBF(alpha)/AML/PEBP2(alpha)) dependent activation of tissue-specific gene transcription.
9887105 1999 PRDI-BF1/Blimp-1 repression is mediated by corepressors of the Groucho family of proteins.
9874198 1998 Transducin-like Enhancer of split 2, a mammalian homologue of Drosophila Groucho, acts as a transcriptional repressor, interacts with Hairy/Enhancer of split proteins, and is expressed during neuronal development.
9854018 1999 Groucho/transducin-like enhancer of split (TLE) family members interact with the yeast transcriptional co-repressor SSN6 and mammalian SSN6-related proteins: implications for evolutionary conservation of transcription repression mechanisms.
9334241 1997 The Groucho/transducin-like enhancer of split transcriptional repressors interact with the genetically defined amino-terminal silencing domain of histone H3.
8808280 1996 Epithelial expression and chromosomal location of human TLE genes: implications for notch signaling and neoplasia.
8365415 1993 Molecular cloning and expression of mouse and human cDNA encoding AES and ESG proteins with strong similarity to Drosophila enhancer of split groucho protein.
1303260 1992 Human homologs of a Drosophila Enhancer of split gene product define a novel family of nuclear proteins.