Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.00

Knowledge Summary

Patent

No data available

Expression

 Compartment GO Term (1)

AA Sequence

MRGLRWRYTRLPSQVEDTLSGEEGNEEEEEEEAAPDPAAAPEDPTVPQLTEASQVLSASEIRQLSFHFPP      1 - 70
RVTGHPWSLVFCTSRDGFSLQSLYRRMEGCSGPVLLVLRDQDGQIFGAFSSSAIRLSKGFYGTGETFLFS     71 - 140
FSPQLKVFKWTGSNSFFVKGDLDSLMMGSGSGRFGLWLDGDLFRGGSSPCPTFNNEVLARQEQFCIQELE    141 - 210
AWLLS                                                                     211 - 215
//

Text Mined References (3)

PMID Year Title