Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.63

Knowledge Summary


No data available


  Differential Expression (8)

Disease log2 FC p
medulloblastoma -1.500 4.6e-04
non-small cell lung cancer 1.333 1.9e-11
intraductal papillary-mucinous adenoma (... 1.300 8.7e-05
Breast cancer 1.800 3.8e-12
ductal carcinoma in situ 1.800 4.1e-03
invasive ductal carcinoma 1.900 7.0e-03
ovarian cancer 1.600 2.5e-06
psoriasis -1.100 7.8e-36

AA Sequence

LLMLDVMIIIYFSRLLRSDFCPEHVPKKQHKDKFLTE                                     211 - 247

Text Mined References (5)

PMID Year Title
23673622 2013 Calfacilitin is a calcium channel modulator essential for initiation of neural plate development.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12151215 2002 TRAM, LAG1 and CLN8: members of a novel family of lipid-sensing domains?