Property Summary

NCBI Gene PubMed Count 16
PubMed Score 106.57
PubTator Score 41.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
adrenocortical carcinoma 1427 1.4e-10
aldosterone-producing adenoma 664 6.1e-03
Disease Target Count Z-score Confidence
Yellow fever 14 3.415 1.7

Expression

  Differential Expression (2)

Disease log2 FC p
adrenocortical carcinoma -2.890 1.4e-10
aldosterone-producing adenoma -1.976 6.1e-03

Protein-protein Interaction (2)

Gene RIF (4)

PMID Text
24569995 analysis of human triokinase/FMN cyclase reveals that kinase activity requires intact homodimers, but cyclase requires only a truncated, single domain subunit
24289155 The peptide fragment (m/z 520.3) of DAK is a promising biomarker to guide timing of antiviral treatment and to avoid liver biopsy in compensated chronic hepatitis B patients.
17600090 DAK, the physiological suppressor of cytoplasmic viral RNA sensor MDA5, specifically inhibits MDA5- but not RNA helicase RIG-I-mediated innate antiviral signaling.
16289032 Evidence supports that a single protein sustains both FMN cyclase and ATP-dependent Dha kinase activities, probably in a single active center

AA Sequence

MTSKKLVNSVAGCADDALAGLVACNPNLQLLQGHRVALRSDLDSLKGRVALLSGGGSGHEPAHAGFIGKG      1 - 70
MLTGVIAGAVFTSPAVGSILAAIRAVAQAGTVGTLLIVKNYTGDRLNFGLAREQARAEGIPVEMVVIGDD     71 - 140
SAFTVLKKAGRRGLCGTVLIHKVAGALAEAGVGLEEIAKQVNVVAKAMGTLGVSLSSCSVPGSKPTFELS    141 - 210
ADEVELGLGIHGEAGVRRIKMATADEIVKLMLDHMTNTTNASHVPVQPGSSVVMMVNNLGGLSFLELGII    211 - 280
ADATVRSLEGRGVKIARALVGTFMSALEMPGISLTLLLVDEPLLKLIDAETTAAAWPNVAAVSITGRKRS    281 - 350
RVAPAEPQEAPDSTAAGGSASKRMALVLERVCSTLLGLEEHLNALDRAAGDGDCGTTHSRAARAIQEWLK    351 - 420
EGPPPASPAQLLSKLSVLLLEKMGGSSGALYGLFLTAAAQPLKAKTSLPAWSAAMDAGLEAMQKYGKAAP    421 - 490
GDRTMLDSLWAAGQELQAWKSPGADLLQVLTKAVKSAEAAAEATKNMEAGAGRASYISSARLEQPDPGAV    491 - 560
AAAAILRAILEVLQS                                                           561 - 575
//

Text Mined References (19)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24569995 2014 Bifunctional homodimeric triokinase/FMN cyclase: contribution of protein domains to the activities of the human enzyme and molecular dynamics simulation of domain movements.
24289155 2013 Serum dihydroxyacetone kinase peptide m/z 520.3 as predictor of disease severity in patients with compensated chronic hepatitis B.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21269460 2011 Initial characterization of the human central proteome.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17600090 2007 Negative regulation of MDA5- but not RIG-I-mediated innate antiviral signaling by the dihydroxyacetone kinase.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16289032 2005 Identification of human and rat FAD-AMP lyase (cyclic FMN forming) as ATP-dependent dihydroxyacetone kinases.
15771780 2005 A comprehensive update of the sequence and structure classification of kinases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
4688871 1973 Dihydroxyacetone metabolism by human erythrocytes: demonstration of triokinase activity and its characterization.