Property Summary

NCBI Gene PubMed Count 70
PubMed Score 142.59
PubTator Score 92.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (23)

Protein-protein Interaction (1)

Gene RIF (29)

PMID Text
25712527 Claudin-19, the most abundant claudin in myelin, exhibited no binding to ZO2.
24660027 Exposure of brain micro vascular endothelial cells to HIV-1 Tat results in a decrease of claudin-1, claudin-5, and zonula occludens-2 expression and cellular redistribution of claudin-5, suggesting potential disturbance of the blood-brain barrier by Tat
24614073 Protein-truncating mutations in the tight junction protein 2 gene cause failure of protein localization and disruption of tight-junction structure, leading to severe cholestatic liver disease.
23885123 JAM-A regulates epithelial permeability via association with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and control contraction of the apical cytoskeleton.
23612256 the Alu-related transcript of TJP2 gene (TJP2-Alu transcript) was differentially expressed between colorectal tumor and normal tissues; potential diagnostic markers for colorectal cancer.
23605953 demonstrated that ZO-2 inhibition increases invasive and migrative capacities of invasive tumor cells. This was associated with an increase of MT1-MMP
22671599 ZO-2 inhibits the Wnt signaling pathway, reduces cell proliferation, and promotes apoptosis; its absence, mutation, or overexpression is present in various human diseases, including deafness and cancer.
22591361 Exposure of brain micro vascular endothelial cells to HIV-1 Tat results in a decrease of claudin-1, claudin-5, and zonula occludens-2 expression and cellular redistribution of claudin-5, suggesting potential disturbance of the blood-brain barrier by Tat
21685940 AmotL1 and ZO-2 are two candidates that could be harnessed to control the oncogenic function of YAP.
21679692 these findings imply involvement of the ZO-2 tight junction independent signaling complex containing Jak1 and uPAR in VSMC intercellular communications.
21641584 Exposure of brain micro vascular endothelial cells to HIV-1 Tat results in a decrease of claudin-1, claudin-5, and zonula occludens-2 expression and cellular redistribution of claudin-5, suggesting potential disturbance of the blood-brain barrier by Tat
20868680 The identification of ZASP helps to unfold the complex nuclear molecular arrays that form on ZO-2 scaffolds.
20868367 ZO-2 interacts with YAP2 to form complex; ZO-2 facilitates both nuclear translocation of YAP2 & pro-apoptotic function of YAP2; YAP2/ZO-2 complex appears to be involved in cell detachment
20850437 the first PDZ domain of zona occludens-1 (ZO-1) and 2 (ZO-2) interacts with the carboxy-terminal PDZ binding motif of TAZ
20602916 TJP2- and GSK-3beta-mediated increased susceptibility to apoptosis of cells of the inner ear is the mechanism for adult-onset hearing loss in this kindred and may serve as one model for age-related hearing loss in the general population.
19784548 Study shows that ZO isoforms bind PtdInsPs and offers an alternative regulatory mechanism for the formation and stabilisation of protein complexes in the nucleus.
19418635 ZO-2 may serve to anchor regulatory proteins at gap junctions composed of Cx36.
19380416 The tight junction protein ZO-2 is involved in regulation of vascular smooth muscle cells growth control upon vascular injury that is mediated by the transcription factor Stat1.
19342771 Structural comparison shows that the ZO-2 PDZ2 homodimer may have a similar ligand-binding pattern to the ZO-1 PDZ2-connexin 43 complex.
19148554 upregulation of ZO-2 by Angiopoietin-1 which reduces vascular endothelial growth factor-induced brain endothelial permeability
18667611 Exposure of brain micro vascular endothelial cells to HIV-1 Tat results in a decrease of claudin-1, claudin-5, and zonula occludens-2 expression and cellular redistribution of claudin-5, suggesting potential disturbance of the blood-brain barrier by Tat
18569453 Exposure of brain micro vascular endothelial cells to HIV-1 Tat results in a decrease of claudin-1, claudin-5, and zonula occludens-2 expression and cellular redistribution of claudin-5, suggesting potential disturbance of the blood-brain barrier by Tat
18224337 TJP2 did not reveal a otosclerosis-causing mutation
18003888 Exposure of brain micro vascular endothelial cells to HIV-1 Tat results in a decrease of claudin-1, claudin-5, and zonula occludens-2 expression and cellular redistribution of claudin-5, suggesting potential disturbance of the blood-brain barrier by Tat
17217619 Sertoli cells associated with carcinoma in situ of the testicles show an altered distribution of ZO-2 and loss of blood-testis barrier function.
16697675 Exposure of brain micro vascular endothelial cells to HIV-1 Tat results in a decrease of claudin-1, claudin-5, and zonula occludens-2 expression and cellular redistribution of claudin-5, suggesting potential disturbance of the blood-brain barrier by Tat
15977641 Exposure of brain micro vascular endothelial cells to HIV-1 Tat results in a decrease of claudin-1, claudin-5, and zonula occludens-2 expression and cellular redistribution of claudin-5, suggesting potential disturbance of the blood-brain barrier by Tat
14515355 Exposure of brain micro vascular endothelial cells to HIV-1 Tat results in a decrease of claudin-1, claudin-5, and zonula occludens-2 expression and cellular redistribution of claudin-5, suggesting potential disturbance of the blood-brain barrier by Tat
12704386 Familial hypercholanemia in Amish individuals is associated with mutations in tight junction protein 2 (encoded by TJP2, also known as ZO-2) and bile acid Coenzyme A: amino acid N-acyltransferase (encoded by BAAT).

AA Sequence

MPVRGDRGFPPRRELSGWLRAPGMEELIWEQYTVTLQKDSKRGFGIAVSGGRDNPHFENGETSIVISDVL      1 - 70
PGGPADGLLQENDRVVMVNGTPMEDVLHSFAVQQLRKSGKVAAIVVKRPRKVQVAALQASPPLDQDDRAF     71 - 140
EVMDEFDGRSFRSGYSERSRLNSHGGRSRSWEDSPERGRPHERARSRERDLSRDRSRGRSLERGLDQDHA    141 - 210
RTRDRSRGRSLERGLDHDFGPSRDRDRDRSRGRSIDQDYERAYHRAYDPDYERAYSPEYRRGARHDARSR    211 - 280
GPRSRSREHPHSRSPSPEPRGRPGPIGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDII    281 - 350
LKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERR    351 - 420
HQYSDYDYHSSSEKLKERPSSREDTPSRLSRMGATPTPFKSTGDIAGTVVPETNKEPRYQEDPPAPQPKA    421 - 490
APRTFLRPSPEDEAIYGPNTKMVRFKKGDSVGLRLAGGNDVGIFVAGIQEGTSAEQEGLQEGDQILKVNT    491 - 560
QDFRGLVREDAVLYLLEIPKGEMVTILAQSRADVYRDILACGRGDSFFIRSHFECEKETPQSLAFTRGEV    561 - 630
FRVVDTLYDGKLGNWLAVRIGNELEKGLIPNKSRAEQMASVQNAQRDNAGDRADFWRMRGQRSGVKKNLR    631 - 700
KSREDLTAVVSVSTKFPAYERVLLREAGFKRPVVLFGPIADIAMEKLANELPDWFQTAKTEPKDAGSEKS    701 - 770
TGVVRLNTVRQIIEQDKHALLDVTPKAVDLLNYTQWFPIVIFFNPDSRQGVKTMRQRLNPTSNKSSRKLF    771 - 840
DQANKLKKTCAHLFTATINLNSANDSWFGSLKDTIQHQQGEAVWVSEGKMEGMDDDPEDRMSYLTAMGAD    841 - 910
YLSCDSRLISDFEDTDGEGGAYTDNELDEPAEEPLVSSITRSSEPVQHEESIRKPSPEPRAQMRRAASSD    911 - 980
QLRDNSPPPAFKPEPPKAKTQNKEESYDFSKSYEYKSNPSAVAGNETPGASTKGYPPPVAAKPTFGRSIL    981 - 1050
KPSTPIPPQEGEEVGESSEEQDNAPKSVLGKVKIFEKMDHKARLQRMQELQEAQNARIEIAQKHPDIYAV   1051 - 1120
PIKTHKPDPGTPQHTSSRPPEPQKAPSRPYQDTRGSYGSDAEEEEYRQQLSEHSKRGYYGQSARYRDTEL   1121 - 1190
//

Text Mined References (81)

PMID Year Title
25712527 2015 Biophysical characterization of interactions between the C-termini of peripheral nerve claudins and the PDZ? domain of zonula occludens.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24614073 2014 Mutations in TJP2 cause progressive cholestatic liver disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23885123 2013 JAM-A associates with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and regulate epithelial barrier function.
23612256 2013 Alu-related transcript of TJP2 gene as a marker for colorectal cancer.
23605953 2013 Regulation of membrane-type 1 matrix metalloproteinase expression by zonula occludens-2 in human lung cancer cells.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22671599 2012 ZO-2, a tight junction scaffold protein involved in the regulation of cell proliferation and apoptosis.
22665060 2013 Nuclear import of LASP-1 is regulated by phosphorylation and dynamic protein-protein interactions.
22044751 2011 Heritability and genome-wide association analysis of renal sinus fat accumulation in the Framingham Heart Study.
22006950 2011 Lulu2 regulates the circumferential actomyosin tensile system in epithelial cells through p114RhoGEF.
21685940 2012 Opposing roles of angiomotin-like-1 and zona occludens-2 on pro-apoptotic function of YAP.
21679692 2011 The tight junction protein ZO-2 and Janus kinase 1 mediate intercellular communications in vascular smooth muscle cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20868680 2010 Identification of ZASP, a novel protein associated to Zona occludens-2.
20868367 2010 Functional complexes between YAP2 and ZO-2 are PDZ domain-dependent, and regulate YAP2 nuclear localization and signalling.
20850437 2010 TAZ interacts with zonula occludens-1 and -2 proteins in a PDZ-1 dependent manner.
20602916 2010 Genomic duplication and overexpression of TJP2/ZO-2 leads to altered expression of apoptosis genes in progressive nonsyndromic hearing loss DFNA51.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19784548 2009 The PDZ2 domain of zonula occludens-1 and -2 is a phosphoinositide binding domain.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19538295 2009 Zonula occludens-1 and -2 are cytosolic scaffolds that regulate the assembly of cellular junctions.
19418635 Direct association of connexin36 with zonula occludens-2 and zonula occludens-3.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19380416 2009 The tight junction protein ZO-2 mediates proliferation of vascular smooth muscle cells via regulation of Stat1.
19342771 2009 Structure of the second PDZ domain from human zonula occludens 2.
19148554 2009 Angiopoietin-1 reduces vascular endothelial growth factor-induced brain endothelial permeability via upregulation of ZO-2.
18823282 2009 Characterization of the ubinuclein protein as a new member of the nuclear and adhesion complex components (NACos).
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18224337 2008 A new locus for otosclerosis, OTSC8, maps to the pericentromeric region of chromosome 9.
18088087 2008 Phosphoproteome of resting human platelets.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17897942 2007 Domain-swapped dimerization of the second PDZ domain of ZO2 may provide a structural basis for the polymerization of claudins.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17217619 2006 Altered expression of ZO-1 and ZO-2 in Sertoli cells and loss of blood-testis barrier integrity in testicular carcinoma in situ.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15975580 2005 hScrib interacts with ZO-2 at the cell-cell junctions of epithelial cells.
15768832 2004 Molecular basis of intrahepatic cholestasis.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15570572 2005 Automated immobilized metal affinity chromatography/nano-liquid chromatography/electrospray ionization mass spectrometry platform for profiling protein phosphorylation sites.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15164053 2004 DNA sequence and analysis of human chromosome 9.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15054114 2004 The specific fates of tight junction proteins in apoptotic epithelial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14515355 2003 HIV-1 Tat protein alters tight junction protein expression and distribution in cultured brain endothelial cells.
14512431 2003 In vitro protein complex formation with cytoskeleton-anchoring domain of occludin identified by limited proteolysis.
12829691 2003 Atypical recognition consensus of CIN85/SETA/Ruk SH3 domains revealed by target-assisted iterative screening.
12704386 2003 Complex inheritance of familial hypercholanemia with associated mutations in TJP2 and BAAT.
12645256 2002 [LIM protein KyoT2 interacts with human tight junction protein ZO-2-i3].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403786 2003 The tight junction protein ZO-2 localizes to the nucleus and interacts with the heterogeneous nuclear ribonucleoprotein scaffold attachment factor-B.
12152786 2002 Interferon-beta counteracts inflammatory mediator-induced effects on brain endothelial cell tight junction molecules-implications for multiple sclerosis.
12023291 2002 Evidence for a functional interaction between cingulin and ZO-1 in cultured cells.
11855865 2002 Nuclear localization of the tight junction protein ZO-2 in epithelial cells.
11598001 2001 Link of the unique oncogenic properties of adenovirus type 9 E4-ORF1 to a select interaction with the candidate tumor suppressor protein ZO-2.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11042084 2000 Human and Xenopus cingulin share a modular organization of the coiled-coil rod domain: predictions for intra- and intermolecular assembly.
11018256 2000 Organization and expression of the human zo-2 gene (tjp-2) in normal and neoplastic tissues.
10966866 2000 MAGUK proteins: structure and role in the tight junction.
10874042 2000 Characterization of the interaction between protein 4.1R and ZO-2. A possible link between the tight junction and the actin cytoskeleton.
10613913 1999 Cingulin contains globular and coiled-coil domains and interacts with ZO-1, ZO-2, ZO-3, and myosin.
10601346 1999 Direct binding of three tight junction-associated MAGUKs, ZO-1, ZO-2, and ZO-3, with the COOH termini of claudins.
10575001 1999 Protein interactions at the tight junction. Actin has multiple binding partners, and ZO-1 forms independent complexes with ZO-2 and ZO-3.
10495427 1999 zo-2 gene alternative promoters in normal and neoplastic human pancreatic duct cells.
10360833 1999 Tight junction protein ZO-2 is differentially expressed in normal pancreatic ducts compared to human pancreatic adenocarcinoma.
10026224 1999 Characterization of ZO-2 as a MAGUK family member associated with tight as well as adherens junctions with a binding affinity to occludin and alpha catenin.
9458817 1998 Molecular structure and assembly of the tight junction.
8824195 1996 The tight junction protein ZO-2 contains three PDZ (PSD-95/Discs-Large/ZO-1) domains and an alternatively spliced region.
7951235 1994 The Friedreich ataxia region: characterization of two novel genes and reduction of the critical region to 300 kb.
7542259 1995 Epidermal growth factor induces tyrosine phosphorylation and reorganization of the tight junction protein ZO-1 in A431 cells.