Property Summary

NCBI Gene PubMed Count 201
PubMed Score 1368.86
PubTator Score 611.79

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (19)

Disease log2 FC p
acute quadriplegic myopathy 1.167 3.5e-04
Astrocytoma, Pilocytic 1.100 5.6e-04
atypical teratoid / rhabdoid tumor 1.100 5.8e-04
dermatomyositis 1.500 7.1e-04
Down syndrome 1.100 2.7e-03
ependymoma 1.400 6.6e-08
esophageal adenocarcinoma -1.700 2.3e-02
glioblastoma 1.100 8.6e-03
group 4 medulloblastoma 2.100 2.3e-05
intraductal papillary-mucinous neoplasm ... 1.300 1.1e-02
lung adenocarcinoma -1.100 6.3e-18
lung cancer -1.300 1.1e-03
malignant mesothelioma -2.100 6.5e-08
mucosa-associated lymphoid tissue lympho... 1.492 3.2e-02
osteosarcoma 2.205 1.5e-04
ovarian cancer -2.300 6.3e-08
psoriasis 1.100 1.3e-03
spina bifida -2.195 3.7e-02
subependymal giant cell astrocytoma -1.008 2.9e-02

PDB (18)

Gene RIF (150)

AA Sequence

MSARAAAAKSTAMEETAIWEQHTVTLHRAPGFGFGIAISGGRDNPHFQSGETSIVISDVLKGGPAEGQLQ      1 - 70
ENDRVAMVNGVSMDNVEHAFAVQQLRKSGKNAKITIRRKKKVQIPVSRPDPEPVSDNEEDSYDEEIHDPR     71 - 140
SGRSGVVNRRSEKIWPRDRSASRERSLSPRSDRRSVASSQPAKPTKVTLVKSRKNEEYGLRLASHIFVKE    141 - 210
ISQDSLAARDGNIQEGDVVLKINGTVTENMSLTDAKTLIERSKGKLKMVVQRDERATLLNVPDLSDSIHS    211 - 280
ANASERDDISEIQSLASDHSGRSHDRPPRRSRSRSPDQRSEPSDHSRHSPQQPSNGSLRSRDEERISKPG    281 - 350
AVSTPVKHADDHTPKTVEEVTVERNEKQTPSLPEPKPVYAQVGQPDVDLPVSPSDGVLPNSTHEDGILRP    351 - 420
SMKLVKFRKGDSVGLRLAGGNDVGIFVAGVLEDSPAAKEGLEEGDQILRVNNVDFTNIIREEAVLFLLDL    421 - 490
PKGEEVTILAQKKKDVYRRIVESDVGDSFYIRTHFEYEKESPYGLSFNKGEVFRVVDTLYNGKLGSWLAI    491 - 560
RIGKNHKEVERGIIPNKNRAEQLASVQYTLPKTAGGDRADFWRFRGLRSSKRNLRKSREDLSAQPVQTKF    561 - 630
PAYERVVLREAGFLRPVTIFGPIADVAREKLAREEPDIYQIAKSEPRDAGTDQRSSGIIRLHTIKQIIDQ    631 - 700
DKHALLDVTPNAVDRLNYAQWYPIVVFLNPDSKQGVKTMRMRLCPESRKSARKLYERSHKLRKNNHHLFT    701 - 770
TTINLNSMNDGWYGALKEAIQQQQNQLVWVSEGKADGATSDDLDLHDDRLSYLSAPGSEYSMYSTDSRHT    771 - 840
SDYEDTDTEGGAYTDQELDETLNDEVGTPPESAITRSSEPVREDSSGMHHENQTYPPYSPQAQPQPIHRI    841 - 910
DSPGFKPASQQKAEASSPVPYLSPETNPASSTSAVNHNVNLTNVRLEEPTPAPSTSYSPQADSLRTPSTE    911 - 980
AAHIMLRDQEPSLSSHVDPTKVYRKDPYPEEMMRQNHVLKQPAVSHPGHRPDKEPNLTYEPQLPYVEKQA    981 - 1050
SRDLEQPTYRYESSSYTDQFSRNYEHRLRYEDRVPMYEEQWSYYDDKQPYPSRPPFDNQHSQDLDSRQHP   1051 - 1120
EESSERGYFPRFEEPAPLSYDSRPRYEQAPRASALRHEEQPAPGYDTHGRLRPEAQPHPSAGPKPAESKQ   1121 - 1190
YFEQYSRSYEQVPPQGFTSRAGHFEPLHGAAAVPPLIPSSQHKPEALPSNTKPLPPPPTQTEEEEDPAMK   1191 - 1260
PQSVLTRVKMFENKRSASLETKKDVNDTGSFKPPEVASKPSGAPIIGPKPTSQNQFSEHDKTLYRIPEPQ   1261 - 1330
KPQLKPPEDIVRSNHYDPEEDEEYYRKQLSYFDRRSFENKPPAHIAASHLSEPAKPAHSQNQSNFSSYSS   1331 - 1400
KGKPPEADGVDRSFGEKRYEPIQATPPPPPLPSQYAQPSQPVTSASLHIHSKGAHGEGNSVSLDFQNSLV   1401 - 1470
SKPDPPPSQNKPATFRPPNREDTAQAAFYPQKSFPDKAPVNGTEQTQKTVTPAYNRFTPKPYTSSARPFE   1471 - 1540
RKFESPKFNHNLLPSETAHKPDLSSKTPTSPKTLVKSHSLAQPPEFDSGVETFSIHAEKPKYQINNISTV   1541 - 1610
PKAIPVSPSAVEEDEDEDGHTVVATARGIFNSNGGVLSSIETGVSIIIPQGAIPEGVEQEIYFKVCRDNS   1611 - 1680
ILPPLDKEKGETLLSPLVMCGPHGLKFLKPVELRLPHCDPKTWQNKCLPGDPNYLVGANCVSVLIDHF     1681 - 1748
//

Text Mined References (213)

PMID Year Title