Property Summary

NCBI Gene PubMed Count 18
PubMed Score 264.87
PubTator Score 47.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
Multiple myeloma 1.549 8.7e-03
urothelial carcinoma -1.100 2.3e-02
osteosarcoma 1.144 6.3e-03
cystic fibrosis 1.349 8.9e-06
medulloblastoma, large-cell -1.800 2.4e-05
acute quadriplegic myopathy 1.376 2.3e-06
adrenocortical carcinoma -3.039 4.9e-12
tuberculosis -1.100 1.0e-02
non-small cell lung cancer -1.113 1.2e-09
Hydrolethalus syndrome 1.497 4.8e-02
lung cancer -3.800 3.1e-06
colon cancer -1.100 1.4e-02
active ulcerative colitis 1.345 9.7e-03
diabetes mellitus -1.400 3.8e-02
group 4 medulloblastoma -1.200 2.4e-03
lung adenocarcinoma -1.200 7.1e-05
psoriasis -1.300 3.2e-08
inflammatory breast cancer -1.700 3.9e-05
lung carcinoma -1.500 4.9e-15
spina bifida -1.387 4.0e-02
acute myeloid leukemia 1.600 4.0e-02
ovarian cancer 1.600 2.5e-03
chronic rhinosinusitis -1.372 2.8e-02
pancreatic cancer 1.100 3.9e-02

Pathway (1)

Gene RIF (6)

PMID Text
26814197 these data identify a new mechanism of LXR regulation that involves TIPARP, ADP-ribosylation and MACROD1.
24806346 Knockdown of TiPARP, but not AHRR, increased 2,3,7,8-tetrachlorodibenzo-p-dioxin - induced CYP1A1 mRNA and AHR protein levels.
24162774 HIV-1 gp120 upregulates the expression of TCDD-inducible poly(ADP-ribose) polymerase (TIPARP) in human B cells
20852632 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20852632 Single nucleotide polymorphism in TIPARP is associated with ovarian cancer.
12851707 TIPARP (DKFZp434J214) gene is amplified in HNSCC. TIPARP, FLJ22693 and ZAP proteins with TPH, WW and PARP-like domains constitute the TIPARP family.

AA Sequence

MEMETTEPEPDCVVQPPSPPDDFSCQMRLSEKITPLKTCFKKKDQKRLGTGTLRSLRPILNTLLESGSLD      1 - 70
GVFRSRNQSTDENSLHEPMMKKAMEINSSCPPAENNMSVLIPDRTNVGDQIPEAHPSTEAPERVVPIQDH     71 - 140
SFPSETLSGTVADSTPAHFQTDLLHPVSSDVPTSPDCLDKVIDYVPGIFQENSFTIQYILDTSDKLSTEL    141 - 210
FQDKSEEASLDLVFELVNQLQYHTHQENGIEICMDFLQGTCIYGRDCLKHHTVLPYHWQIKRTTTQKWQS    211 - 280
VFNDSQEHLERFYCNPENDRMRMKYGGQEFWADLNAMNVYETTEFDQLRRLSTPPSSNVNSIYHTVWKFF    281 - 350
CRDHFGWREYPESVIRLIEEANSRGLKEVRFMMWNNHYILHNSFFRREIKRRPLFRSCFILLPYLQTLGG    351 - 420
VPTQAPPPLEATSSSQIICPDGVTSANFYPETWVYMHPSQDFIQVPVSAEDKSYRIIYNLFHKTVPEFKY    421 - 490
RILQILRVQNQFLWEKYKRKKEYMNRKMFGRDRIINERHLFHGTSQDVVDGICKHNFDPRVCGKHATMFG    491 - 560
QGSYFAKKASYSHNFSKKSSKGVHFMFLAKVLTGRYTMGSHGMRRPPPVNPGSVTSDLYDSCVDNFFEPQ    561 - 630
IFVIFNDDQSYPYFVIQYEEVSNTVSI                                               631 - 657
//

Text Mined References (20)

PMID Year Title
26814197 2016 TCDD-inducible poly-ADP-ribose polymerase (TIPARP/PARP7) mono-ADP-ribosylates and co-activates liver X receptors.
24806346 2014 Aryl hydrocarbon receptor repressor and TiPARP (ARTD14) use similar, but also distinct mechanisms to repress aryl hydrocarbon receptor signaling.
23544013 2013 Genome-wide association study in BRCA1 mutation carriers identifies novel loci associated with breast and ovarian cancer risk.
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
23275542 2013 2,3,7,8-Tetrachlorodibenzo-p-dioxin poly(ADP-ribose) polymerase (TiPARP, ARTD14) is a mono-ADP-ribosyltransferase and repressor of aryl hydrocarbon receptor transactivation.
20852632 2010 A genome-wide association study identifies susceptibility loci for ovarian cancer at 2q31 and 8q24.
20106667 2010 Toward a unified nomenclature for mammalian ADP-ribosyltransferases.
18762178 2008 A human intervention study with foods containing natural Ah-receptor agonists does not significantly show AhR-mediated effects as measured in blood cells and urine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16202152 2005 In silico characterization of the family of PARP-like poly(ADP-ribosyl)transferases (pARTs).
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15273990 2004 The PARP superfamily.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12851707 2003 Identification and characterization of human TIPARP gene within the CCNL amplicon at human chromosome 3q25.31.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.