Property Summary

NCBI Gene PubMed Count 24
PubMed Score 11.28
PubTator Score 6.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 3.0e-07
psoriasis 6694 3.6e-05
osteosarcoma 7950 7.3e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Craniosynostosis 74 3.262 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.800 3.0e-07
osteosarcoma -1.641 7.3e-05
psoriasis -2.000 3.6e-05

Gene RIF (2)

AA Sequence

MWRCPLGLLLLLPLAGHLALGAQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRADDCALPYLGAI      1 - 70
CYCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWDNCNRCTCQENRQWQCDQEPC     71 - 140
LVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEAS    141 - 210
EKWPNLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDTHQQQGCRGGRLDGAWW    211 - 280
FLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSND    281 - 350
KEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKY    351 - 420
WTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH                           421 - 467
//

Text Mined References (26)

PMID Year Title