Property Summary

NCBI Gene PubMed Count 22
PubMed Score 10.01
PubTator Score 6.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
malignant mesothelioma 3163 3.0e-07
psoriasis 6685 3.6e-05
osteosarcoma 7933 7.3e-05
Disease Target Count Z-score Confidence
Craniosynostosis 47 3.318 1.7

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 1.800 3.0e-07
psoriasis -2.000 3.6e-05
osteosarcoma -1.641 7.3e-05

Gene RIF (2)

PMID Text
25521548 TINAGL1 and B3GALNT1 are possible candidates for drug compounds that inhibit their gene expression
25514977 Double immunofluorescence analysis showed that CTLA-2alpha was co-localized with cathepsin L, cathepsin C, and TINAGL1 in placenta.

AA Sequence

MWRCPLGLLLLLPLAGHLALGAQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRADDCALPYLGAI      1 - 70
CYCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWDNCNRCTCQENRQWQCDQEPC     71 - 140
LVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEAS    141 - 210
EKWPNLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDTHQQQGCRGGRLDGAWW    211 - 280
FLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSND    281 - 350
KEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKY    351 - 420
WTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH                           421 - 467
//

Text Mined References (24)

PMID Year Title
25521548 2014 TINAGL1 and B3GALNT1 are potential therapy target genes to suppress metastasis in non-small cell lung cancer.
25514977 2015 Identification and characterization of the interactive proteins with cytotoxic T-lymphocyte antigen-2?.
25416956 2014 A proteome-scale map of the human interactome network.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22261194 2012 Proteomics analysis of cardiac extracellular matrix remodeling in a porcine model of ischemia/reperfusion injury.
20551380 2010 Proteomics characterization of extracellular space components in the human aorta.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12482659 2002 Interaction of human papillomavirus type 16 L2 with cellular proteins: identification of novel nuclear body-associated proteins.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12358155 2002 Screening the proteins that interact with calpain in a human heart cDNA library using a yeast two-hybrid system.
11170462 2001 TIN-ag-RP, a novel catalytically inactive cathepsin B-related protein with EGF domains, is predominantly expressed in vascular smooth muscle cells.
10799322 2000 Cloning, characterization, and expression of the human TIN-ag-RP gene encoding a novel putative extracellular matrix protein.