Property Summary

NCBI Gene PubMed Count 394
PubMed Score 1098.41
PubTator Score 954.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count
Spontaneous abortion 113
Disease Target Count Z-score Confidence
Connective tissue disease 62 0.0 1.9

Expression

Protein-protein Interaction (3)

Gene RIF (370)

AA Sequence

MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQ      1 - 70
YEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQ     71 - 140
KKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPP    141 - 210
KQEFLDIEDP                                                                211 - 220
//

Text Mined References (396)

PMID Year Title