Property Summary

NCBI Gene PubMed Count 539
PubMed Score 3513.40
PubTator Score 2273.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (31)

Gene RIF (518)

PMID Text
27089280 High TIMP1 expression is associated with Sepsis.
26973196 determined normal concentration ranges for MMP-1, MMP-2, MMP-9, TIMP-1, and ratios of concentrations of MMPs and TIMP-1 (MMP-1/TIMP-1, MMP-2/TIMP-1, MMP-9/TIMP-1) in the amniotic fluid at the first period of labor in physiological pregnancy.
26861446 Metformin simultaneously increases VEGFA and reduces CXCL10 and TIMP1 in CD34(+) cells in a model of the diabetic state combined with hypoxia to stimulate angiogenesis.
26856083 The MMP9 (A8208G) as well as TIMP1 (C5367) genetic polymorphisms are not associated with calcific aortic stenosis.
26844501 protective effect of rs4898 C allele on male Parkinson disease
26782559 MMP-1 expression is increased in intervertebral disc degeneration, with higher expression observed in more severe cases, whereas TIMP-1 expression was similarly expressed in both normal and degenerated discs.
26782378 These results suggest that in the progression of renal aging, high expression of TIMP-1 up-regulates PTEN expression indicating that PTEN and TIMP-1 are involved in the aging-associated impairment of renal angiogenesis
26730601 Data show that serum neuron-specific enolase, cytokeratin 19 fragment 21-1, pro-gastrin-releasing peptide, squamous cell carcinoma antigen, tissue inhibitor of metalloproteinase-1, and human epididymis protein 4 are not associated with brain metastases.
26722039 The CC genotype of TIMP1 rs4898 compared to the TT wild-type genotype may increase lung cancer risk in Taiwan and may serve as a marker for early detective and predictive purposes.
26718740 activation of TLR7 upregulated the expression levels of IFN-lambda1 and MMP-9 were increased by ~3 fold, whereas other genes (p53, PTEN, TIMP-1) were upregulated by ~2 fold, and VEGF was marginally upregulated after 10 min.
26681056 These results show that increased MMP-8 and decreased TIMP-1 expressions are closely related to the invasive pituitary adenoma, and can be helpful for the evaluation.
26626455 It demonstrated that MMP-9 to TIMP-1 ratio was positively associated with body weight and waist circumference 3 years after a 12-week low-calorie-diet weight-reduction program in men with metabolic syndrome.
26539028 TIMP1, TIMP2, and TIMP4 are increased in aqueous humor from primary open angle glaucoma patients.
26490574 suggest better clinical usefulness of MMP-9 and TIMP-1 expression in cholesteatoma tissues than either serum or plasma levels of these proteins
26399271 TIMP-1 and MMP-9/TIMP-1 ratio, but not MMP-9, were good diagnostic biomarkers of sepsis-associated acute kidney injury
26366732 TIMP-1 dependent inhibition of apoptosis occurs through p90RSK, with phosphorylation of the pro-apoptotic protein BAD at serine 112, ultimately reducing Bax levels and increasing mitochondrial permeability.
26329758 TIMP1 is elevated in patients with non-alcoholic fatty liver disease.
26268417 The expression levels MMP-9, TIMP-1, and TIMP-2 in both marrow plasma and culture supernatants were significantly higher in MM patients than controls.
26254391 This prospective study validates a previous study testing the detection of Colorectal Cancer based on TIMP-1 and CEA levels.
26213230 These findings indicate that rhTIMP-1 promotes clonogenic expansion and survival in human progenitors via the activation of the CD63/PI3K/pAkt signaling pathway
26197083 Genes expression of MMP9, VEGFA and TIMP1 in peripheral blood leukocytes may play a pivotal role in regulation of progression of bladder cancer; TIMP1 expression may be important factor for early recurrence.
26193199 the confirmation of MMP-9 and TIMP-1 value as prognostic factors, based on immunohistochemical expression, requires a threshold validation.
26168159 TIMP-1 contributes to the development of diet-induced hepatic steatosis and glucose intolerance and may be a potential therapeutic target
26120586 Patients with Primary Open-Angle Glaucoma are characterized by an increased mRNA expression of MMP1, MMP9, MMP12, TIMP1 and IL-1b genes as compared to the control group .
26077878 TIMP1 was correlated with diastolic dysfunction in new-onset heart failure outpatients.
26002577 In melanoma patients at stages I-III, the high concentrations of TIMP-1 in serum predicted adverse prognosis. YKL-40 was associated with ulceration of primary tumor, which is a very important prognostic factor
25998046 miR-377 downregulated p53, PTEN and TIMP1 expression by directly targeting the 3'-untranslated region of these target genes. Collectively, miR-377 potentially served as a new molecular predictive biomarker of GC tumorigenesis and prognosis
25951835 Interestingly, endotoxin tolerance significantly upregulated TIMP1 relative to MMP9 and downmodulated MMP9 secretion and its enzymatic activity.
25932641 This study showed modest to moderate effects of MMP-9 and TIMP-1 polymorphisms on spontaneous deep intracerebral hemorrhage risks with significant age differences.
25895516 TIMP-1 significantly increased levels of alpha-SMA.
25868389 High expression of TIMP1 gene is associated with papillary thyroid carcinoma.
25854270 higher TIMP-1 levels are responsible for the development of residual pleural thickening.
25765004 EBV-encoded Zta upregulates TIMP-1 expression by binding to the AP-1 site within the TIMP-1 promoter.
25756591 TIMP-1-overexpressing tumors showed enhanced tumor kinetics and more infiltrative features.
25712810 increased levels in saliva and serum in women with polycystic ovary syndrome, and is
25693084 may play an important role in colorectal cancer development
25674294 Report imbalance between MMP-9 and TIMP-1 levels in prostatic adenocarcinoma which may contribute to neoplasm invasiveness.
25665057 TIMP1 downregulates MMP-2 activity and inhibits the degradation of occluding in Caco-2 intestinal cells
25623427 IHC staining showed higher TR4 level, more macrophage infiltration, lower TIMP-1 and stronger MMP2/MMP9 in tumor tissues.
25608838 We have confirmed the potential prognostic value of TIMP-1 measurement prior to palliative chemotherapy for colorectal cancer
25594187 Results show that TIMP-1 expression is growth pattern dependent in colorectal cancer liver metastases. At the metastasis periphery, TIMP-1 could have MMP inhibitory activity, and in the pericytes it could be involved in tumor angiogenesis.
25578494 this study presents novel functions of TIMP-1 in promoting cancer metastasis and suggests TIMP-1 is a potential tissue biomarker for lymph invasion and distant metastasis of lung adenocarcinoma.
25549087 miR-29a repressed TAB1-mediated TIMP-1 production in dermal fibroblasts, demonstrating that miR-29a may be a therapeutic target in SSc.
25532000 TIMP1 expression was up-regulated in colorectal neoplasms.
25470608 a possible coordinated role of VEGF-A and MMP-2 during uterine leiomyomas growth and angiogenesis with potential prognostic significance
25470073 Urinary Emmprin, MMP-9 and TIMP-1 may be noninvasive potential biomarkers that could be used for long-term follow-up of children with UPJ narrowing on conservative treatment to determine those who might develop obstruction.
25466591 SNPs rs4898 and rs6609533 associated with increased risk of early aseptic loosening failure of total hip replacement
25436070 MMP-2, MMP-9, TIMP-1, and TIMP-2 may have important roles in the development and progression of MFH.
25407832 TIMP-1 levels were predictive of risk stratification and early diagnosis of sepsis in the emergency department.
25360794 Our results show that proMMP-9 trimers constitute a novel structural and functional entity that is differentially regulated by TIMP-1.
25335732 These findings indicate that investigated biomarkers are constructive for early diagnosis of breast cancer and MMP-9/TIMP-1 ratio might be a new significant marker in predicting breast cancer development.
25316052 Levels of ICAM-1 and TIMP-1 were significantly elevated in set 1 in PDAC patients with jaundice compared to PDAC patients without jaundice and both proteins were elevated in patients with jaundice due to gall stones.
25300296 Expression levels of TIMP-1, TIMP-3 and TIMP-4 were negligible (<10% of cells) in primary spontaneous pneumothorax lesions.
25263437 Study shows that an increase of both exogenous and endogenous TIMP-1 led to the upregulation of miR-210 in a CD63/PI3K/AKT/HIF-1-dependent pathway in lung adenocarcinoma cells.
25233933 miR-196 performed it's their function by inhibiting NME4 expression and further activating p-JNK, suppressing TIMP1, and augmenting MMP1/9.
25183545 RAB37 regulates the exocytosis of TIMP1 in a nucleotide-dependent manner to inactivate MMP9 migration axis in vitro and in vivo and to suppress tumor metastasis.
25153995 Our findings indicate that overexpression of MMP-9 and TIMPs in blood mononuclear cells and elevated depressive symptoms represent two unrelated phenomena after myocardial infarction.
25137018 High TIMP-1 protein expression is associated with pancreatic ductal adenocarcinoma.
25128867 No evidence was found for any associations between the TIMP-1,-2,-3, or -4 gene single nucleotide polymorphisms with unexplained recurrent spontaneous abortions in this Han Chinese Han population.
25016699 Studied the plasma concentrations of MMP-8, TIMP1, C-reactive protein, fibrinogen, and WBCs in patients with acute coronary syndrome and found levels were significantly higher than those in the control group.
24986570 upregulation of MMP-2 and MMP-9 and downregulation of TIMP-1, is one of the mechanisms by which Skp2 promotes cell invasion of human renal cancer cells
24976505 These data suggest a pivotal role of the anti-angiogenic factor TIMP-1 in intercellular tumor-endothelial cell communication resulting in anti-angiogenic features of endothelial cells.
24913092 The results suggest that the TIMP-1 g.-9830T>G polymorphism not only promotes PE but also decreases the responses to antihypertensive therapy.
24895412 TIMP-1's function as an endogenous inhibitor of MMP or as a "cytokine-like" signaling molecule may be a critical determinant for tumor cell behavior.
24819588 Inhibition of TIMP activity showed that TIMP-1 and TIMP-2 together were largely responsible for the reduction of migration and invasion by MSCs.
24728097 serum TIMP-1 levels were associated with brain trauma injury mortality.
24727739 non-surviving septic patients showed persistently higher TIMP-1/MMP-9 ratio than survivors ones.
24651234 Increased systemic levels of TIMP-1 were associated with more severe hypoxemia and worse outcome in a large cohort of mechanically ventilated critically ill patients
24635319 Data suggest that TIMP1 functions as chemoattractant for neural stem cells (NSC); TIMP1 enhances NSC adhesion, migration, and cytoskeletal reorganization; these effects are dependent on CD63 antigen (granulophysin) and CD29 (integrin beta1).
24479343 Matrix metalloproteinases (MMP)--MMP-1,-2,-9 and its endogenous activity regulators in transformed by E7 oncogene HPV16 and HPV18 cervical carcinoma cell lines
24457057 The biomarker signature consisting of TNFR-II, TGF-alpha, TIMP-1 and CRP is significantly prognostic of survival in patients with high-risk melanoma.
24447332 High serum TIMP-1 levels in firefighters after the World Trade Center attack predict lung healing.
24442990 the unbalance of the expression of MMP-1 and TIMP-1 along with the growth of the age
24427345 These data indicated that TIMP-1 may be identified as a prognostic marker of laryngeal squamous cell carcinoma
24389602 We found no valuable cut-offs for the TIMP1 and TIMP1/Cr values in hydronephrosis
24347177 The expression of vascular endothelial growth factor (VEGF), matrix metalloproteinase 2 (MMP2), tissue inhibitor of metalloproteinase 1 (TIMP1), interleukin 6 (IL-6), and interleukin 15 (IL-15).
24330623 Despite earlier reports linking MMP-9 and TIMP-1 with prognosis in breast cancer patients there was no association between plasma levels and disease free survival.
24283658 it can be suggested that MMP-8 -799 C/T and TIMP-1 372 T/C, *429 T/G gene polymorphisms in males may be associated with the susceptibility to GAgP in the Turkish population.
24212294 Report strong association between lower levels of circulating pro-MMP1 and TIMP1 and risk of prevalent cardiovascular disease in a general population cohort over 40 years.
24174628 study provides a unifying molecular mechanism for high angiogenic capacity of TIMP-free proMMP-9
24143225 the novel promotive effects of TIMP-1 on cancer progression and on accumulation of cancer associated fibroblasts
24118356 association of the TIMP-1 gene with recurrent aphthous stomatitis was ruled out based on our results.
24113427 gene expression is induced by TGF-beta1 via ERK 1/2 and Sp1 signalling pathways
24068394 MMP2/TIMP2 and MMP9/TIMP1 immunoreactivity was extremely heterogeneous within the analyzed group of secondary liver tumors.
24042342 We found that MMP-1/TIMP-1 and MMP-1/TIMP-2 complexes were suppressed and that MMP-2 activity was upregulated in keratinocytes expressing siTIMP-1 or siTIMP-2.
24039251 These results suggest that SIRT1 protects against COPD/emphysema, in part, via redressing the TIMP-1/MMP-9 imbalance involving TIMP-1 deacetylation.
23998545 Serum levels of MMP-9, TIMP-1 and B(+) Tn-C and tissue levels of B(+) Tn-C and ED-A(+) Fn are promising markers for risk assessment in dilated cardiomyopathy.
23993112 Suggest role for coinfection with both C pneumonia and M pneumoniae in the development of aortic atherosclerotic aneurysms via MMP9/TIMP1.
23967215 Natural haemozoin induces inflammation-mediated expression and release of human monocyte TIMP-1 through p38 MAPK- and NF-kappaB-dependent mechanisms
23962148 Our results suggest that serum MMP-8, TIMP-1, and the ratio of MMP-9/TIMP-1 might be useful adjuncts as predictors of prognosis in patients with hepatocellular carcinoma
23909892 TIMP-1 confers resistance to treatment with the widely used topoisomerase inhibitors in breast and colorectal cancer.
23900236 Analysis revealed a positive correlation between u-PA and MMPs and a negative correlation between u-PA/MMPs and TIMPs.
23893334 TIMP-1 protein expression is a reliable surrogate marker for BRAF-mutated status in papillary thyroid carcinoma
23881388 Data suggest a relation between high expression level of tissue inhibitor of metalloproteinases-1 (TIMP1) and loss of progesterone receptor expression combined with fulvestrant resistance.
23874603 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of TIMP metallopeptidase inhibitor 1 (TIMP1) expression by HIV-1 Vpr in Vpr transduced macrophages
23841813 This is the first association study of the TIMP-1 gene variants with ICH. Our data suggest that C allele of rs2070584 is a risk factor for ICH development in the Chinese male population.
23834019 A literature review showed that elevated protein levels of TIMP-1 in either tumor tissue extracts or in plasma from patients suffering from gastric cancer associates with poor patient outcome.[review]
23817219 human brain microvascular endothelial cells switch to a proinflammatory state by means of an enhanced production of MMP-2, attenuated release of TIMP-1, and unaffected production of TIMP-2
23815085 The ability of TIMP-1 to inhibit MMP-1 is at least in part regulated by outer arm fucosylation of its N-glycans.
23773968 High serum levels of TIMP-1 and VEGF-A were found to be associated with tumor progression and unfavorable prognosis in patients with esophageal cancer.
23768069 The highest level of TIMP-1 was noted in patients with inflammatory pancreatic tumors.
23763354 Data indicate tht mRNA expression of elastin, procollagen I type I, fibronectin, Col1alpha1, and TIMP-1 had a significant increase after bicyclic[1,2,3]triazoles plus UVA treatment, while the MMP-1 decreased, compared with the UVA irradiated group.
23706069 Septic patients with the T allele in the 372 T/C genetic polymorphism of TIMP-1 showed lower survival rate.
23673111 The levels of MMP2, MMP9, TIMP1, and TIMP2 in the peripheral blood of patients with papillary thyroid carcinoma were significantly higher than those with benign thyroid disease and healthy volunteers.
23661104 A significant increase in plasma concentrations of TIMP1 is present in patients with metabolic syndrome.
23660069 These results not only indicate that TIMP-1 is conducive to HSPC homing; they also identify CD63 and beta1-integrin as a TIMP-1 receptor complex on HSPCs.
23650722 the increase of MMP-1 and MMP-9 expression and low of TIMP-1 and TIMP-2 expression makes the main contribution to the destructive (invasive) potential of SCC.
23592002 Smoking does not appear to have any influence on TIMP-1 levels in plasma
23585206 Positive correlations of MMP1, TIMP1 and 2 with pancreatic tumor diameter (CP) were observed, and MMP2 with the duration of surgery and blood loss
23583449 Role of the Src-related kinase Lyn in TIMP-1 induced UT-7 erythroleukemic cell survival.
23563628 TIMP-1 and TIMP-2 gene polymorphisms have roles in progression of liver fibrosis in patients with type C chronic liver disease
23557756 TIMP-1 expression is decreased in woman with endometriosis undergoing in vitro fertilization associated with poor oocyte and embryo development.
23555182 TIMP1 is an upregulated gene product and a proliferative inducer of K-Ras(G12D)-mutated pancreatic ductal cells through the ERK2 signaling pathway.
23548070 High TIMP1 expression levels are associated with disease recurrence in patients with gastric cancer.
23525523 Increased levels of TIMP1 play a role in the development and progression of acute coronary syndrome.
23522389 Timp1 is assembled in a supramolecular complex containing CD63 and beta1-integrins along melanoma genesis and confers anoikis resistance by activating PI3-K signaling pathway.
23509357 MMP-9 gene transfer induces massive neutrophil infiltration and activation of macrophages, whereas TIMP-1 has no effect.
23457635 ERK1/2 signals downstream of C/EBPbeta to facilitate IL-1beta-induced astrocyte TIMP-1 expression.
23412981 There is no difference in the placental TIMP1 and TIMP2 levels in women delivering preterm and at term.
23407481 Data suggest a potential benefit of using osteopontin, TIMP-1, and CA 19-9 in a panel to improve diagnostic accuracy in pancreatic ductal adenocarcinoma.
23388475 Report TIMP1 activity in chronic pancreatitis and pancreatic adenocarcinoma.
23318123 these findings did not demonstrate changes in TIMP-1 expression according to age.
23223421 This study demonstrates profibrotic properties of circulating monocytes from patients with systemic sclerosis and a key role for TLR signalling, particularly TLR8, in TIMP-1 secretion and matrix remodelling.
23179318 Gene expression in dendritic cells of CCL5 and CXCL5 as well as TIMP1 and GUCY1B3 showed a significant increase within the first 4 days after trauma.
23175213 Gambogic acid reduces the invasive potential of osteosarcoma cells via attenuation of MMP-9 and upregulation of TIMP-1.
23158994 Expressions of TIMP-1 and nm-23, tumor size and lymph node involvement were independent prognostic factors in HER-2-positive breast cancer.
23122949 Identification of novel molecules associated with a LIF-mediated increase in trophoblastic cell invasion may facilitate our understanding of implantation biology.
23107442 Serum levels of TIMP-1 were associated with the grade of liver inflammation in chronic hepatitis B patients.
23064462 No expression of TIMP-1 mRNA was detected.
23060593 there is a relationship between higher plasma levels of TIMP1 and an adverse prognosis in patients with liver metastases.
23057632 Abnormal expression of MMP-2 and TIMP-1 might play roles in the development of renal fibrosis in chronic antibody-mediated renal graft rejection.
23043898 The present study suggested that MMP-3/TIMP-1 imbalance is involved in disc herniation.
23016931 NO. Our data support the hypothesis that reduced NO levels leads to the dysregulation of plaque clearance by decreasing the MMP-9/TIMP-1 ratio
22985578 The imbalanced expressions of MMPs-9 and TIMP-1 in injury repair can be related to poor uterine scar healing and early caesarean scar pregnancy.
22975753 CXCL13, MMP-3 and TIMP-1 distinguish active ANCA-associated vasculitis from remission better than the other markers studied, including ESR and CRP.
22971139 Higher level of circulating TIMP-1 is independently associated with worse left ventricular function and with acute heart failure.
22965799 In a previously unrecognized overgrowth syndrome the increased proliferation of fibroblasts and defective collagen I deposition is due to increased MMP3 activitiy and reduced TIMP1 levels.
22957045 tumors with high TIMP-1 and NOS2 behave more aggressively by mechanisms that favor Akt pathway activation
22906271 Primary hypertension resulted in decreased TIMP-1 mRNA levels, suggesting a potential mechanism contributing to the degradation of elastin.
22901654 Radiotherapy changes the expression pattern of MMP-1 and TIMP-1
22883459 MMP-2, MMP-9 and TIMP-2, TIMP-1 may play an important role in the development, progression, invasion and metastasis of non-melanoma skin cancer.
22859303 Overexpression and beta-1,6-N-acetylglucosaminylation-initiated aberrant glycosylation of TIMP-1: a "double whammy" strategy in colon cancer progression.
22820628 The TIMP-1 rs4898 polymorphism may play a protective role in the susceptibility to SSC in females, and in particular to digital ulcer formation.
22788708 Data suggest that cardiac fibrosis, as assessed by serum extracellular matrix protein biomarkers (including TIMP1), develops early in hypertensive patients and is predictive of cardiovascular events or death.
22739984 a novel function, mechanism and direct role of TIMP-1 in neuroprotection
22718114 These data shed light on the important role of TIMP-1 in protection and recovery from cutaneous photodamage because of its suppression of extracellular matrix degradation and inflammation.
22712305 Morphological features of placenta and expression of collagen-6, MMP-1 and TIMP-1 in placental membranes of women with premature rupture of membranes
22706255 inflammatory state induced by elective surgery is associated with increased TIMP-1 response and MMP-9 activity in serum within a few days
22671570 role for variations in MMP3 in chronic periodontitis and report a novel association with TIMP1. These genes may be considered additional candidate genes for chronic periodontitis.
22667130 TGF-beta1, MMP-9 and TIMP-1 may play a role in the tissue remodeling process in allergic rhinitis.
22645431 H. pylori-infected gastric ulcers express higher MMP-7, MMP-9, and TIMP-1 than NSAID-related ulcers
22558080 TIMP-1 modified with a glycosylphosphatidylinositol anchor is bioactive in the nanogram range, enhances mesothelial cell proliferation, and stimulates rapid and efficient wound closure.
22547904 analysis of MMP-9 and TIMP-1 after blunt multiple injuries in the early posttraumatic period
22544540 Our data showed that elevated tumor tissue TIMP-1 levels were significantly associated with a poor response to paclitaxel-based chemotherapy in breast cancer
22532131 The the roles of TIMP-1 in Esophageal cancer (EC) development, tumor progression and formation of metastases have been most extensively characterized and best recognized.
22516898 Systemic TIMP-1 could have the potential of distinguishing perforated from nonperforated appendicitis.
22465225 Kaplan-Meier survival analysis showed a trend with negative TIMP-1 immunostaining and better prognosis of patients with negative estrogen and progesterone receptor status in the primary tumor.
22457727 RUNX3 had the function of inhibiting the proliferative and metastatic abilities of CCRCC cells by regulating cyclins and TIMP1
22427646 Data show that TIMP-1 inhibits the MMP-10 with a K(i) of 1.1 x 10(-9) M, and TIMP-2 inhibits the MMP-10 with a K(i) of 5.8 x 10(-9) M.
22402936 Report increased MMP-9 and reduced TIMP-1 activity in thromboangiitis obliterans patients, especially in active smokers.
22397869 tissue inhibitor of metalloproteinase-1 may have a role in clinical practice as a prognostic and predictive factor for breast cancer.
22364921 Data suggest that TSLP might downregulate NME1 expression via STAT3 signaling pathway, affecting TIMP1 expression in influencing trophoblast invasion.
22305865 Found a significant positive correlation of intraluminal thrombus thickness with active MMP 9 and TIMP 1 concentration in the adjacent abdominal aortic aneurysm wall.
22291969 HDAC inhibitor trichostatin A (TSA) increased the expression of TIMP-1 and TIMP-3 while decreased MMP-2, MMP-9 and uPA and have an inhibitory effect on trophoblast invasion.
22289852 Results support the use of MMP-9 and TIMP-1 as early biomarkers for the presence and extent of perinatal brain injury in human term newborns.
22286923 Perturbations in gene expression of TIMP-1, MMP-1 and HGF were evident in both affected and unaffected skin of the systemic scleroderma patients.
22257687 TIMP-1 serum concentrations are associated with poor outcome in patients with acute coronary syndrome.
22223664 TIMP-1 is a direct regulator of human mesenchymal stem cells functions and reveal a regulatory network in which let-7f modulates Wnt/beta-catenin activity.
22204652 Patients with atrial fibrillation (AF) had lower levels of TIMP-1 compared to those with sinus rhythm (SR) while permanent AF subjects had lower TIMP-1 levels than those with paroxysmal AF.
22200710 Abnormal expressions of MMP-2 and TIMP-1 can promote the development of renal fibrosis in chronic active antibody-mediated renal graft rejection.
22200690 Failed to demonstrate any prognostic relevance of TIMP1 levels in advanced epithelial ovarian neoplasms.
22200256 an increase in the immunodistribution of MMP-2 and -9 and TIMP-1 and -2 in lichen sclerous compared to normal vulvar skin was observed.
22199358 ENPP1 polymorphisms and increase serum TIMP-1 is associated with insulin resistance and cardiomyopathy in patients with kidney failure.
22177802 Small hairpin RNA against uPA and/or uPAR increased secretion of TIMP-1, which is known to enhance SVEGFR1 secretion in endothelial cells and glioblastoma cells.
22139647 TIMP-1 and RECK, are expressed in a reproducible, specific pattern and if the profiles are related to prognosis and clinical outcome in prostate cancer (PC).
22122951 TIMP-1 levels are significantly higher in osteoarthritic knees with clinical effusion than in knees without effusion.
22110238 High TIMP-1 is associated with non-small cell lung cancer.
22051851 TIMP-1, and TIMP-2 and MMP-7 were significantly increased during labor in cervicovaginal fluid.
22020222 the pro-matrix metallopeptidase 9/TIMP-1 ratio measured with ELISA is not a good surrogate measure for active matrix metallopeptidase 9
22016393 Hyaluronan synthase 2 (HAS2) promotes breast cancer cell invasion by suppression of tissue metalloproteinase inhibitor 1 (TIMP-1)
21995626 Although no clear evidence of TIMP-1 transcription in major salivary glands was demonstrated our results suggest that TIMP-1 in saliva does not originate from plasma
21993004 Tamoxifen increased the transcriptional expression of TIMP-1 in SPC-A-1 lung adenocarcinoma cells.
21969093 urine TIMP1 especially may be a useful marker to predict renal scar with a different cut-off value from vesicoureteral reflux and a high specificity at this cut-off point.
21963718 Thioredoxin stimulates MMP-9 expression, de-regulates the MMP-9/TIMP-1 equilibrium and promotes MMP-9 dependent invasion in human MDA-MB-231 breast cancer cells.
21946941 Enhanced expression and activation of MMP-9 was found in septic native knee arthritis compared with aseptic. The presence of high levels of MMP-9 with concomitantly increased MMP-9/TIMP-1 ratio may be indicative for infection.
21928345 Report activity of MMP2/9 and TIMP-1 in electromagnetic field-exposed THP-1 cells.
21903858 BRAF(V600E) causes upregulation of TIMP-1 via NF-kappaB. TIMP-1 binds then its surface receptor CD63, leading eventually to Akt activation, which in turn confers antiapoptotic behavior and promotion of cell invasion.
21882477 Changes of MMP-9 and TIMP-1 levels in gingival crevicular fluid during orthodontic tooth movement under orthodontic forces
21881840 MMP-9, MMP-13 and TIMP-1 expression may serve as a prognostic marker for early tumor invasiveness. Moreover, up-regulation of TIMP-1 in tumor and/or surrounding stromal cells may indicate an increased risk for BCC recurrence.
21860087 TIMP-1 cerebrospinal fluid levels separates the profiles of patients with Alzheimer's disease from those with vascular dementia.
21858035 Study suggests that TIMP-1 is clinically useful for predicting liver fibrosis in HCV pediatric patients.
21786179 The aim of our study was to compare the immunohistochemical expression of TIMP1 and TIMP2 between an uncontrollably invasive phenomenon (cancer) and an "in situ" process (trophoblast invasion)
21763297 The SNP rs6609533 of TIMP-1 gene interacted with PIM3 of alpha(1)AT to make a possible risk combination for development of COPD.
21745383 Elevated serum levels of the invasion markers TIMP-1 and CAIX in metastatic breast cancer are prognostic markers and are associated with the presence of circulating tumor cells
21731773 heparin is able to accelerate the hydrolysis of TIMP-1 by HNE.
21720458 Short-term, high-dose rosuvastatin therapy has no effect on matrix metalloproteinase-13 and tissue inhibitor of metalloproteinase-1 levels in hypercholesterolemic patients.
21709637 no differences found in the genotype and allele distributions and odds ratios of the TIMP1 polymorphism between primary open angle glaucoma(POAG)patients and controls; ffound no association of TIMP1 with MMP1 gene-gene interaction and risk of POAG
21684102 overexpression of TIMP-1 could significantly decrease the sensitivity of MDA-435 breast cancer cells to epirubicin and paclitaxel.
21586274 These data demonstrate that there is a fine balance between CCNL1 and TIMP1, which may contribute to breast cancer development.
21547130 Data show that increased MMP-1 and TIMP-1 are associated with gastric cancer.
21535601 Dehydroechinoside A significantly increased the expression level of TIMP-1, an important regulator of MMP-9 activation.
21524282 TIMP1 Phe124Phe contributes to excess FEV1 decline in two independent prospective cohorts. SNPs in MMPs evidently do not contribute to FEV1 decline in the general population.
21506705 TIMP-1 was significantly down-regulated in hepatocellular carcinoma patients
21487066 Data suggest that plasma markers: CEACAM, ICAM-1, osteopontin, MIA, TIMP-1 and S100B particularly when assessed in combination, can be used to monitor patients for disease recurrenc.
21463121 Findings show significant correlations between MMP-2, -9, and syndecan-1 and hemostatic parameters in hematologic malignancies, in contrast, the MMP inhibitors, TIMP1- and -2, were not correlated with any of the hemostatic parameters.
21454617 analysis of interactions of the catalytic domain (cd) of MMP-1 with the inhibitory domains of TIMP-1 and TIMP-2 (N-TIMPs) and MMP-3cd with N-TIMP-2
21437772 TIMP1 is a negative regulator of adipogenesis. TIMP1 leads to enlarged adipocytes in the state of overnutrition.
21437624 Data indicate that the balance between MMPs and TIMPs in women with PCOS is altered, probably due to androgen excess found in these women.
21427648 TIMP-1 levels were high in abdominal aortic aneurysm patients and low in inguinal hernia patients.
21283828 In this community-based cohort of elderly men, serum MMP-9 and TIMP-1 levels were related to mortality risk.
21211402 TIMP-1 666C > T polymorphism present in north Chinese young men may lead to lumbar intervertebral disc degeneration.
21167221 analysis of an aberrant glycoform of human tissue inhibitor of metalloproteinase-1 (TIMP-1)
21165404 We revealed a positive correlation between serum levels of TIMP-1 in patients with primary ovarian cancer and the size of the primary tumor
21163810 High serum TIMP-1 is associated with glioblastoma.
21128246 instead of regulating matrix metalloproteinase 9 (MMP9) expression, RUNX3 expression inhibited MMP9 enzyme activity, and this was consistent with the upregulation of tissue inhibitor of metalloproteinases 1 (TIMP1) by RUNX3.
21115936 Increased serum TIMP1 is associated with chemoradiation therapy in rectal cancer.
21094936 Findings of this study indicate a dominant expression of MMP-9 over TIMP-1 in saliva reflective of periodontal clinical status.
21086628 Expression of matrix metalloproteinases 2 and 9 and their tissue inhibitors 1 and 2 in papillary thyroid cancer: an association with the clinical, morphological and ultrastructural characteristics of a tumor
21041986 investigation of regulation of TIMP1 expression (and MMP9 expression) in trophoblasts under cell hypoxia as a model of placentation under physiological stress (a model for roles of TIMP1/MMP9 in cellular events leading to preeclampsia)
20921293 High TIMP-1 is associated with peritoneal injury.
20889295 Short-term use of statins is not associated in reducing levels of TIMP 1 in areas of low and peak wall stress in patients with abdominal aortic aneurysms.
20854182 Only circulating TIMP-1 levels were significantly different between H. pylori-positive and -negative children.
20853162 NGAL may be considered a novel stress protein, whereas MMP-7, MMP-9, and TIMP-1 may be regarded as indicators of stress response in the pediatric population on chronic dialysis
20838751 Report increased levels of TIMP-1 in acute coronary syndrome.
20798956 TIMP-1 interaction with alphavbeta3 integrin confers resistance to human osteosarcoma cell line MG-63 against TNF-alpha-induced apoptosis.
20707923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20685094 study showed that autoimmune-mediated dysthyroidism was associated with increased peripheral blood concentrations of vascular cell adhesion molecule-1(VCAM-1), intercellular adhesion molecule-1(ICAM-1) and tissue inhibitor of metalloproteinases 1(TIMP-1)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20655547 The present study demonstrated elevated plasma levels of TIMP-1 and TGF-beta1 in Duchenne muscular dystrophy and congenital muscular dystrophy.
20654099 Right atrial up-regulation of MMP-3, MMP-9 and TIMP-1 levels may contribute to the right atrial structural remodeling in myocardial infarction patients.
20646231 Findings of significantly elevated serum MMP-9, myeloperoxidase, and neutrophil elastase together with decreased TIMP-1 in smoker periodontitis patients provides support for the smoking associated risk of cardiovascular diseases in periodontitis patients
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20616161 Observational study of gene-disease association. (HuGE Navigator)
20595097 high osteopontin levels may support high tissue inhibitor of metalloproteinases-1 levels in autoimmune lymphoproliferative syndrome and Dianzani's autoimmune lymphoproliferative disease, and hence worsen the apoptotic defect in these diseases.
20587546 Observational study of gene-disease association. (HuGE Navigator)
20584750 Enhanced expression of TIMP1 is associated with progression from non-dysplastic Barrett's oesophagus to adenocarcinoma.
20556397 serum TIMP-1 was significantly higher in patients with CRC than in CA patients. Concentrations of TIMP-1 correlated with tumor stage, nodal involvement, presence of distant metastases, patients' survival, and tumor resectability
20545310 This work quantifies the effect of a single point mutation on the protein conformational dynamics and function of TIMP-1.
20545111 TIMP-1 expression had no relationship with lymph node metastasis in nasopharyngeal carcinoma.
20533294 There was a significant increase in the expression of MMP-9 (matrix metallopeptidase 9) and TIMP-1(tissue inhibitor of metalloproteinases 1) in patellar tendons of patients with tendinopathy.
20514432 Data show that gene expression rates of MMP-2 and TIMP-1 were higher in ONFH biopsies whereas TIMP-2 and MMP-9 gene expression was not significantly altered.
20484597 Observational study of gene-disease association. (HuGE Navigator)
20459644 TIMP-1 immunoreactivity in tumour tissue from patients with primary epithelial ovarian cancer did not correlate with patient survival or response to combination platinum/cyclophosphamide therapy.
20452482 Observational study of gene-disease association. (HuGE Navigator)
20450704 After dsRNA stimulation expression of TIMP-1 mRNA did not change in human nasal polyp epithelial cells.
20423842 The high expression of MMP-1 and low expression of TIMP-1 in endometriotic tissues confer strong invasiveness of ectopic endometrial tissue, and may play an important role in the pathogenesis of endometriosis.
20388222 TIMP-1 and VEGF serum levels changed significantly during first-line therapy of ovarian cancer patients and predicted prognosis.
20371206 Observational study of gene-disease association. (HuGE Navigator)
20361393 study demonstrated that increased TIMP-1 serum levels are found in severely obese patients and particularly in these with metabolic syndrome, while weight loss of more than 5% resulted in reduction of TIMP-1 levels
20305574 A reduction in the MMP-9/TIMP-1 ratio is a milieu that favors subepithelial airway remodeling in chronic asthma.
20298300 Patients with COPD had significantly higher plasma levels of IL8(interleukin8) and significantly lower levels of TIMP-1 (tissue inhibitor of metalloproteinase-1) than smokers and non-smokers.
20215736 changes in the extracellular matrix metabolism during the ageing process influence the level of circulating MMP-3 and MMP-10, as well as their tissue inhibitors TIMP-1 and TIMP-2, in a healthy population
20193458 The expression of TIMP-1 showed a negative correlation with the tumor cell differentiation in papillary carcinoma and follicular carcinoma of thyroid.
20164040 TIMP-1 expression in interstitial inflammatory infiltrate cells was the independent prognostic factor for patients' survival.
20111696 Sputum samples from cystic fibrosis patients had elevated human neutrophil elastase (HNE) levels which correlated with an increased MMP-9/TIMP-1 ratio. Confirmed the TIMP-1 cleavage site for HNE is at Valine(69)-Cysteine(70).
20095885 Preoperative serum carcinoembryonic antigen and plasma TIMP-1 levels are independent predictors of Disease-free survival in patients with primary resectable colorectal cancer.
20051489 In cultured granulosa-lutein cells, strong accumulation of TIMP-1 was observed in the ER-Golgi.
20041335 The primary tumors from patients with LR showed significantly higher percentage of TIMP-1 expression in stromal cells compared to primary tumors from patients with distant metastasis or primary tumors from patients without tumoral progression.
20039537 Through alveolar macrophage mediation SiO2 can accelerate the expression of TIMP-1 and collagen III, and inhibit the expression of MMP-1 in human lung fibroblasts.
20030715 Our results reveal that lipopolysaccharide of P. gingivalis is a relatively potent inducer of MMP-9, but a weak inducer of TIMP-1, contributing to a high MMP-9/TIMP-1 ratio.
20021931 In rosiglitazone-treated macrophages, PPAR-gamma mRNA expression was significantly lower while NF-kappaB P65, TIMP-1 and MMP-9 expression were significantly higher in acute coronary syndrome group than in controls.
19927649 SiO2 may affect the expression of MMP-9 and MMP-9 activity in cultured alveolar macrophages.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19911067 Data show that plasma MMP-1 and TIMP-1 levels reflect their colonic mucosal expression to some extent in patients with ulcerative colitis.
19904223 Data show that TIMP-1 and cytokeratin-10 were identified as 2 newly synthesized secreted proteins in MIA PaCa-2 cells after oxythiamine treatment.
19889076 The host MMP-9 -1562/TIMP-1 372 SNPs had gender differences in the risk of intestinal metaplasia after H. pylori infection.
19889076 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19887890 Results suggest that MMP-9 and TIMP-1 overexpression are early markers of breast carcinogenesis preceding tumor invasion.
19875168 evaluates the mRNA expression profile of genes TIMP1, TIMP2, MMP2 and MMP9 in diagnostic bone marrow samples from 134 consecutive ALL children by real-time quantitative PCR
19863693 study investigated whether host uPA is a crucial protagonist for the TIMP-1-induced modulation of a pro-metastatic microenvironment in the liver
19814619 expression of MMP-2 and TIMP-1 was found to be higher in lung cancer patients. Finally, we claim that determination of MMP-9 enzyme levels and expression of MMP-2 and -9 and TIMP-1 can be used as a marker in lung cancer.
19796534 The cerebrospinal fluid MMP-9/TIMP-1 (Matrix metalloproteinase 9/ tissue inhibitors of metalloproteinase-1) ratio was significantly increased in neuro-Behcets disease group compared to controls.
19781774 pre-treatment serum TIMP-1 is associated with advanced myeloma
19766963 A value of 148.27 or more identifies patients with nonalcoholic steatohepatitis with 85.7% sensitivity.
19758569 Individuals with TIMP-1_372C/C genotype were at significantly higher risk of endometrial cancer.
19758569 Observational study of gene-disease association. (HuGE Navigator)
19747478 TIMP-1 mRNA and TIMP-1 protein expression increased with increasing concentrations of TSP-1.
19728856 findings suggest that the plasma TIMP-1 is a better biomarker than the serum TIMP-1 and might be useful for the diagnosis of GC and prognosis of patient survival.
19723899 There is an association of at least 2 X-chromosomal genes with rheumatoid arthritis: TIMP1 and IL9R.
19723899 Observational study of gene-disease association. (HuGE Navigator)
19723139 TIMPs were immunoreactive mainly in epithelium rather than in stroma of pleomorphic adenomas of salivary glands.
19717938 Elevated levls of TIMP1 are present in ruptured anterior cruciate ligament.
19653096 TIMP-1 is associated with objective response to chemotherapy for metastatic breast cancer.
19637058 approximate 40% of plasma specimens from healthy individuals had detectable levels of the MMP-2:TIMP-1 complexes
19629003 In patients with pancreatic cancer, the serum levels of MMP-9, TIMP-1, and tumor markers were higher as compared with those in patients with chronic pancreatitis and healthy subjects.
19609944 Data showed that the TIMP-1-based decrease in PTX-induced apoptosis was reversed by cyclin B1.
19608737 the novel TIMP-free MMP-9/FGF-2/FGFR-2 pathway in proMMP-9-induced angiogenesis in a mammalian setting.
19596921 TIMP-1 expression is increased only in carcinoma, but not in benign lung disease
19560452 Data show that mortality was significantly associated with adiponectin, resistin, PIIINP, MMP-2, TIMP-1, and serum creatinine.
19551542 The migration of bone marrow (BM) mesenchymal stromal cells was the result of the variable level of MMP/TIMP in response to inflammatory stimuli.
19524176 In hypertensive patients, decreased TIMP-1 activity could lead to accumulation of poorly cross-linked, immature and unstable fibril degradation products, which result in misdirected deposition of collagen
19513566 Negative regulation of TIMP1 is mediated by transcription factor TWIST1.
19506087 This study indicates that in human subjects, the long-term sequelae of diseases such as diabetes that cause chronic renal failure result in decreased TIMP-1 and MMP-1 proteins in renal glomeruli.
19464975 TIMP1 higher expression in scar tissues than controls
19430729 This study showed that low TIMP-1 immunohistochemical expression predicts longer overall survival in glioblastoma patients, suggesting a role for TIMP-1 as a biomarker in glioblastoma.
19390929 Overexpression of TIMP-1 is associated with gastric cancer.
19387352 Report relationship between serum MMP-9 and TIMP-1 levels and left ventricular measures and cardiovascular risk factors: a population-based study.
19383344 TIMP-1 was up-regulated in human colorectal cancer samples compared with normal tissue, while TIMP-2 was down-regulated.
19383343 the ability of estradiol to affect MMP-9 and TIMP-1 expression is connected with ERalpha status
19383295 The two splice variants of TIMP-1 may hold important clinical information, and either alone or in combination with measurement of full-length TIMP-1 they may improve the prognostic and/or predictive value of TIMP-1 analyses
19358835 Obese children and adolescents had higher circulating MMP-8 concentrations, lower plasma TIMP-1 concentrations, and higher MMP-8/TIMP-1 ratios than non obese controls.
19336475 Observational study of gene-disease association. (HuGE Navigator)
19331801 Combined hyperlipidemic patients have increased levels of prothrombotic and microinflammatory parameters and higher levels of MMP-2, MMP-9, TIMP-1, and TIMP-2 than control subjects.
19288452 Evaluated MMP-2 and -9, along with their inhibitors TIMP-1 and -2, in pre-eclamptic women compared with normotensive pregnancy and non-pregnant women.Results confirm that MMP-2 and TIMP-1 values are significantly higher in preeclampsia.
19246282 Retinoic acid can reduce the expression of MMP-1 and increase the expression of TIMP-1 in cultured human fibroblasts exposed to heat shock.
19141395 The results revealed that mononuclear cells were highly immunoreactive for TIMP-1, TIMP-2 and MMP-9 during viral meningitis and that the expression of TIMPs in polymorphonuclear cells was even higher during bacterial meningitis.
19134356 The elevated expression of MMP-9 and TIMP-1 may influence the behavior of ghost cell odontogenic carcinoma.
19036126 An imbalance between TIMP-1 and TIMP-4 serum levels is present in inflammatory bowel disease (ulcerative colitis and Crohn's disease) patients.
19020757 Serous and mucinous ovarian tumors express different profiles of TIMP-1.
19019896 findings highlight the importance of the MMP-3 and TIMP-1 genes as crucial elements in ankylosing spondylitis development.
19019896 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19012952 a possible role for TIMP-1 in the pathology of adult human dental tissues following an injury such as a caries lesion
18984437 Higher TIMP-1 was associated with carotid stenosis (OR for Quartiles (Q)4 v Q1-3, 1.63, P = .022) and a higher internal carotid media thickness(beta 0.057 +/- 0.025, Q4 v Q1-3, P = .023).
18945772 HCMV infection specifically alters the MMP-9/TIMP-1 balance in human macrophages, which in turn reduces MMP-9 activity in infected cells.
18854176 These results demonstrate that integrin alphavbeta3-mediated transcriptional regulation of MMP-9 and TIMP-1 is critical for suppressing the ovarian cancer cell invasion.
18850474 the equilibrium between MMP-9 and TIMP-1 is important in lymphomas in addition to all the physiological and pathologic events although MMP-9 and the TIMP-1 staining patterns are not related to the tumor stage, prognosis, and type of the disease
18787947 the effects of TIMP-1 differ significantly in a 2-D environment compared to the 3-D environment and that TIMP-1 stimulates tumor growth.
18704317 MMP-9 and TIMP-1 might play an important role in the development of systemic sclerosis.
18692810 Formation of adenomyosis does not result from altered invasiveness of endometrial stromal cells, but may result in elevation of MMP-2 and TIMP-1.
18683786 There was a significant correlation between over-expression of ICAM-1 and TIMP-land MMP-9 in lung tissues from patients with chronic obstructive pulmonary disease.
18645261 Plasma TIMP-1 is a potential marker for predicting tumour progression and for monitoring tumour burden in metastatic breast cancer patients.
18636124 Observational study of gene-disease association. (HuGE Navigator)
18634035 The T allele at TIMP-1 SNP +372 T/C was found to be associated with an increased risk for surgical recurrence in Crohn's disease.
18634035 Observational study of gene-disease association. (HuGE Navigator)
18630499 Tumour invasion in colorectal liver metastasis is associated with increased TIMP-1 RNA and protein levels in both tumour and host cells.
18502033 TIMP1 functions as a differentiating and survival factor of GC B cells by modulating CD44 and SHP1 in the late centrocyte/post-GC stage, regardless of EBV infection.
18487063 hematopoiesis was not adversely affected by TIMP-1 or TIMP-2
18477480 Higher plasma pro-MMP-9 levels, and higher pro-MMP-9/TIMP-1 ratios in women with gestational hypertension
18474748 Atorvastatin does not alter interferon Beta-induced changes of serum matrix metalloproteinase 9 and tissue inhibitor of metalloproteinase 1 in patients with multiple sclerosis.
18395263 MMP-9(matrix metalloproteinase-9) /TIMP-1 (tissue inhibitor of metalloproteinase-1 )ratios of SSPE (subacute sclerosing panencephalitis)patients were significantly higher than controls.
18391843 The absolute concentration of TIMP-1 in the airway, rather than its molar ratio with MMP-9, was associated with persistent wheezing.
18385523 TIMP-1 interacts with matrix metalloproteinases and regulates matrilysin activity during airway epithelial repair.
18298349 serum OPG, RANKL, MMP-1 and TIMP-1 may have roles in mediating myocardial healing after myocardial infarct
18292822 The dysregulated TIMP1 expression is associated with infertility and early pregnancy loss.
18291374 TIMP-1, -2, and -3 are significantly reduced by chorionic gonadotropin in endometrial stromal cells.
18273688 Fibroblast-derived TIMP-1 acts on endothelial cells in a pro-angiogenic capacity.
18236174 results suggest that relaxin may promote the invasive potential of early placental EVTs through up-regulating MMP-2, -9 mRNAs and down-regulating TIMP-1 mRNA in EVTs.
18217401 MMP-2, TIMP-1 and TIMP-2 levels are significantly higher and MMP-9 lower in children with chronic hepatitis B
18214300 Immunoassays showed significantly elevated content type 1 tissue inhibitor of metalloproteinases in tumors compared to adjacent histologically unchanged mucosa of patients with colorectal cancer.
18159069 Increased expression of TIMP-1 mediates an anti-invasive effect of cannabinoids. Cannabinoids may therefore offer a therapeutic option in the treatment of highly invasive cancers.
18063811 FOXO3a (forkhead box O3) increased the expression of MMP-3 (stromelysin-1) but decreased the expression of tissue inhibitors of metalloproteinases-1 (TIMP-1)in human umbilical vein endothelial cells
18049028 serum level significantly and positively correlated with carotid-femoral pulse wave velocity in hypertensive patients
18042068 MMP-2, MMP-9, TIMP-1 and TIMP-2 play an important role in the pathogenesis of non-melanoma skin cancer. The immunoexpression of these proteins may be useful indicators of cutaneous cancer invasion and progression.
18034264 Abundant peritumoral expression of TIMP-1 in non-immunocompromised patients limits extracellular matrix degradation permissive for cancer cell migration.
18025061 Patients with larger aortic diameters have increased MMP-2/TIMP-1.
17998244 TIMP-1 carries independent prognostic information when measured in blood, especially plasma.
17928006 imbalance of serum matrix metallopeptidase 9 and tissue inhibitors of metalloproteinases 1 levels in patients with acute encephalopathy following prolonged febrile seizures may be associated with severe neurological sequelae
17920311 Meta-analysis of gene-disease association. (HuGE Navigator)
17899257 Observational study of gene-disease association. (HuGE Navigator)
17899257 No association between genetic polymorphisms of the TIMP-1 gene and abdominal aortic aneurysm was found, suggesting that variations in the TIMP-1 gene do no contribute to the development of AAA.
17893005 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17878270 Tissue inhibitor of metalloproteinase-1 (TIMP-1), was identified as a target protein for GnT-V in human colon cancer cell WiDr.
17786346 Increased Timp-1 is assopciated with squamous cell laryngeal carcinoma
17763191 The present results do not support the current hypothesis that tumour cells contribute substantially to increased plasma TIMP-1 levels observed in patients with colorectal cancer.
17726014 The findings suggest that pericellular production of HOCl by phagocytes, generated by the MPO-H2O2-chloride system, is a pathogenic mechanism for impairing TIMP-1 activity during inflammation.
17703334 The median level of TIMP-1 (tissue inhibitor of metalloproteinase 1) was elevated in Juvenile Idiopathic Arthritis (JIA) patients as compared to controls; MMP3/TIMP-1 ratio correlated with measures of disease activity
17660250 Constraining specificity in the N-domain of TIMP1 was studied.
17634538 Plasma TIMP-1 levels are significantly and independently associated with objective response in patients with metastatic colorectal cancer receiving combination chemotherapy.
17589947 Observational study of gene-disease association. (HuGE Navigator)
17589947 Allelic composition at the examined SNPs in genes coding for TIMP-1 and MMP-3 affect Crohn's disease susceptibility and/or phenotype, i.e., fistulizing disease, stricture pathogenesis and first disease localisation.
17572998 An imbalance between MMP-9 and TIMP-1 in induced sputum in asthmatics and COPD is associated with airway inflammation and airflow limitation.
17564313 Expression of TIMP1 was evaluated in hepatocellular carcinoma and surrounding non-tumor tissue.
17549663 BLood TIMP-1 levels of plasma from healthy blood donors were not significantly diffrent from colorectal patients.
17543340 Primary colorectal cancers and metastatic liver lesions showed highly significant differences in MMP-1, -10, -11, and TIMP-1.
17493602 Results of this study suggest that Systemic sclerosis patients with anticentromere antibodies positivity, after a primary fibrogenetic noxa, react with a more abundant release of MMP/TIMP, whereas patients with anti-Scl70 antibody show a normal response.
17489740 The 82 kDa proMMP-9 expressed on the surface of malignant cells may escape inhibition by natural TIMP-1, thereby facilitating cellular invasion in vivo.
17478562 High concentrations of TIMP1-v1+2 mRNA are associated with good prognosis in patients with primary breast cancer.
17456311 TGFbeta1 and TIMP-1 are involved in the course of developing hepatic fibrosis and TIMP-1 may be regulated by TGFbeta1.
17409012 Results showed that the endogenous TIMP1 might be involved in skin development and in maintenance of
17380436 TIMP-1 demonstrated an inhibitory effect on angiogenesis, and may be worthwhile investigating for use as a future therapy for peritoneal dissemination.
17350093 Positive correlation was found between hepatosplenomegaly and the MMP-2/TIMP-1 ratio
17340613 TIMP1 regulates cell proliferation by interacting with the ninth zinc finger domain of PZLF.
17301822 Caspase-3 and the p38alpha MAP kinase were activated during TIMP-1-induced UT-7 cells erythroid differentiation.
17299802 The production of matrix metalloproteinases (MMPs), tissue inhibitors of MMPs, and plasminogen activators by gingival fibroblasts stimulated with lipopolysaccharides produced by periodontopathogens, are reported.
17226791 The aim of the present study was to investigate the effect of P. gingivalis on the expression and production of MMP-2, MMP-9, TIMP-1, and TIMP-2 by oral fibroblasts and epithelial cells.
17222415 TIMP-1 and TIMP-2 have a differential relationship with haemostatic proteins and roles in hemostasis and thrombogenesis
17209789 Increased TIMP-1 levels in gingival crevicular fluid are associated with the enhanced severity of periodontal inflammation, indicating that it can participate in the regulation of disease progression.
17205957 Plasma concentrations of MMP-2, MMP-9, TIMP-1, and TGF-beta1 significantly differed between the various histopathological types of primary glomerulonephritis.
17202148 a TIMP-1 mutant (K26/27/30 + K76 transplant) capable of ECM association.
17192464 Overexpression of TIMP-1 in beta-cells enhances the replication of pancreatic islets beta-cells and counteracts type 1 diabetes, indicating that the TIMP-1 gene may be a potential target to prevent, or even reverse, type 1 diabetes.
17182940 Observational study of gene-disease association. (HuGE Navigator)
17162914 Early TIMP-1 production by retinal pigment epithelial cells in cell cultures was enhanced following laser exposure.
17136882 elevated TIMP-1 levels may reflect the degree of hepatic fibrosis and development of portal hypertension with biliary atresia; TIMP-1 may play a role in the pathophysiology of post-Kasai biliary atresia.
17114213 In the present exploratory study, it showed that elevated tumor tissue TIMP-1 levels were significantly associated with a poor response to chemotherapy of a group of patients with metastatic breast cancer.
17072372 The suppressive effect of human recombinant tissue inhibitor of metalloproteinases-1(TIMP-1; rh-TIMP-1) on tumor proliferation using an in vivo xenograft system is reported.
17071711 Increased expression of TIMP-1 may reflect a specific temporal inhibition of collagenolysis and thereby a time-dependent regulation of ECM breakdown in areas surrounding the apex of the follicle.
17050530 analysis of the catalytic domain of matrix metalloproteinase-1 in complex with the inhibitory domain of tissue inhibitor of metalloproteinase-1
17045024 Pulmonary fibrosis may be associated with increased TIMP-1 and decreased MMP-9/TIMP1.
17012236 This study proposes a novel mechanism of TIMP-1 regulation, which ensures an increased supply of the inhibitor after brain injury, and limits extracellular matrix degradation.
17009408 Excessive expression of MMP-1 and TIMP-1 in the diseased colonic mucosa causes excessive hydrolysis of the extracellular matrix (ECM) and ulceration in ulcerative colitis (UC) patients.
17008230 TIMP-1 may serve as a useful laboratory marker to predict the clinical outcome of patients presenting with severe sepsis.
16996520 data indicate a significant positive correlation of TIMP-1 levels and the incidence of positive remodelling of coronary artery or increased plaque burden
16960901 Observational study of gene-disease association. (HuGE Navigator)
16960901 These findings suggest that the +372T>C polymorphism of the TIMP-1 gene is associated with Systemic sclerosis (SSc) in male individuals.
16940985 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
16935611 Observational study of gene-disease association. (HuGE Navigator)
16935611 The two genes (MMP3 and TIMP1) may not play a crucial role for high myopia in young Taiwanese men.
16931892 hTIMP-1 reduces aneurysm formation in ApoE(-/-) mice but does not protect them against the development of arterial lesions
16880228 These findings make plausible the involvement of MMP-9/TIMP-1 imbalance in the invasiveness of the endometrial tissue of patients with endometriosis and the ectopic development of the disease.
16877361 These reuslts show a significant association between the expression of the phosphorylated/active form of STAT3 (pSTAT3) and that of TIMP1.
16864898 metalloproteinase-9 and tissue inhibitor of metalloproteinases-1 may have roles in development of systemic lupus erythomatosus
16840178 plasma levels and activities of MMP-2, MMP-9, and TIMP-1 are increased in hypertensive patients, which may reflect abnormal extracellular matrix metabolism
16786122 an increased ratio of MMP-9 to TIMP-1 might be associated with the formation of microcysts and peritumoral edema in microcystic meningioma
16772717 Increase in serum levels eight days after IVIG treatment in neuromuscular disease.
16767366 High levels of tissue inhibitor of metalloproteinase-1 is associated with recurrence in patients with gastric cancer
16754484 results suggest that both MMP-9 and TIMP-1 contribute to tissue remodeling in asthma
16631927 TIMP-1 and TIMP-2 are major serum factors that stimulate the induction of TIMP-1 mRNA in quiescent human gingival fibroblasts (Gin-1 cells) at mid-G1 (6-9 h after serum stimulation) of the cell cycle, but not that of TIMP-2.
16615041 protein expression levels of TIMP-1 were higher in colorectal tumor tissues than in the corresponding normal tissues
16555295 TIMP-1 expression is regulated through multiple mechanisms. Transcriptional control and loss of mRNA stabilization are, however, the most likely primary contributors to chronic downregulation of TIMP-1.
16496359 We propose that one of the mechanisms involved in TIMP-1 downregulation may be through TGF-signaling in chronic immune activation. These studies show a novel extracellular regulatory loop in astrocyte-TIMP-1 regulation.
16474379 Data suggest that tissue expression of TIMP1 could be a useful marker to predict the progression and metastasis of hepatocellular carcinoma.
16410344 Coordinated down-regulation of collagen & TIMP-1 and up-regulation of MMP-1 occurs in fibroblasts exposed to proteasome inhibitors, indicating the proteasome's role in fibrosis and extracellular matrix remodeling.
16407831 TIMP-1-mediates cell-cycle arrest via cyclin D1 downregulation & p27KIP1 upregulation. TIMP-1 modulation of these proteins is achieved through differential regulation of protein stability independent of growth factor signaling or cell adhesion.
16372907 During exacerbation, increased inflammatory burden coincides with an imbalance of the proteinase MMP-9 and its cognate inhibitor TIMP-1
16288711 results suggest that gingival fibroblast are stimulated by monocytes resulting in enhanced expression of MMP-1 and TIMP-1 and that the enhanced MMP-1 expression, in contrast to TIMP-1, is partly mediated by ICAM-1 and the signal pathway p38 MAPK
16280123 Homozygous familial hypercholesterolemia patients exhibited significantly elevated level of active TIMP-1.
16269968 there is a differential association of TIMP-1 with carotid-femoral pulse-wave velocity, intima-media thickness at the common carotid arteries, and carotid plaques
16248458 In chronic rhinosinusitis and nasal polyps tissues the expression of TGF-beta1, MMP-7, MMP-9, TIMP-1 protein was significant increased compared to controls.
16219294 We hereby propose a new method to overproduce human recombinant TIMP-1 by transient expression in HEK293E cells.
16191301 In acute stage of Kawasaki disease, serum MMP-9 level and the ratio of MMP-9/TIMP-1 were higher in patients with coronary artery lesion than those in patients without CAL.
16188099 AP-1 Decoy inhibits the increase in MMP-2 activity and the up-regulation of TIMP-1 induced by bleomycin-A5 in pulmonary fibroblasts.
16107690 TIMP-1 secretion is profoundly decreased in erythroid cells from fetal livers of transgenic knock-in mice homozygous for a GATA(S310A) gene
16103240 Cardiac expression of TIMP-1 and TIMP-2 is significantly increased in chronic pressure-overloaded human hearts compared with controls and is related to the degree of interstitial fibrosis
16100012 TIMP1 transcripts increased during acute lung injury in mice
16061701 Observational study of gene-disease association. (HuGE Navigator)
16042227 a magnetic resonance imaging (MRI) measure of disease activity in multiple sclerosis patients during treatment with rIFNbeta-1a.
16019435 analysis of species specificity of human and bovine TIMP-1 binding to mouse TIMP-1 receptor
16005367 Plasma MMP-2, TIMP-1 and hs-CRP concentrations were significantly increased in type-2 diabetic patients.
15944607 Observational study of gene-disease association. (HuGE Navigator)
15944607 genetic variations in TIMP1 may contribute to pathogenesis of abdominal aortic aneurysm
15896974 matrix metallopeptidase 9/TIMP-1 system and beta-chemokines could cooperate in conditions of elevated oxidative stress, which ultimately predisposes hemodialysis patients to accelerated atherosclerosis
15890357 Oncostatin M regulates TIMP1 through extracellular signal-regulated MAP kinases in cardiac myocytes.
15888067 Significantly elevated tissue inhibitor of metalloproteinase 1 in broncho-alveolar lavage fluid is associated with Bronchiolitis obliterans
15867221 Study suggest that TIMP-1 might be related to both tumor growth and metastasis in head and neck squamous cell carcinoma.
15841325 evidence that cell density influences the invasive potential of tumor cells via regulation of MMPs and TIMP-1 and TIMP-2 by AP-1, NF kappa B and CRE transcription factors
15818737 in hepatocellular carcinoma cells, fibril- and fixed-collagen have opposite effects on MMP-1 production without affecting TIMP production
15797648 altered MMP/TIMP ratios in maternal blood during gestational hypertension
15754388 Overexpressing functional TIMP-1- enhanced migration of HepG2-TIMP-1 cells depends on enhanced MMP-activity, especially MMP-9.
15754326 Over expression of TIMP-1 is associated with nonsmall cell lung carcinoma
15616792 This study found an up-regulation of TIMP-1, TIMP-2 and MMP-2 RNA in Duchenne Muscular Dystrophy muscle.
15557756 The expression of MMP-2, MMP-9, TIMP-1, and TIMP-2 was lower in the benign and low malignancy ovarian tumors compared with the malignant ones.
15530852 data suggest that TIMP-1 inhibits HDMVEC migration through MMP-dependent stimulation of VE-cadherin and MMP-independent stimulation of PTEN with subsequent dephosphorylation of FAK and cytoskeletal remodeling.
15516987 Intrinsic TIMP-1 expression in myeloid leukemia cells might impact upon survival or differentiation
15515157 Specifically, increased expression of SERPIN-A (proteinase inhibitor-alpha antitrypsin) and TIMP 1 (tissue inhibitor of metalloproteinase 1) identified these as candidate molecular biomarkers for Papillary Thyroidi Carcinoma.
15494493 Enhancement of TIMP-1 production by tumor-derived prostaglandin E2 correlates with reduced dendritic cell migration through the tumor extracellular matrix.
15485866 experiments demonstrate that sphingosine kinase 1/sphingosine-1-phosphate are important components of the transforming growth factor-beta signaling pathway involved in up-regulation of the tissue inhibitor of metalloproteinase-1 (TIMP-1)
15479729 Validation of TIMP-1 expression in human lymphoma cell lines and primary B-cell tumors with plasmacytic/plasmablastic phenotypes, including multiple myelomas, supports TIMP-1 as an important factor in the pathogenesis of plasmacytic/plasmablastic tumors.
15465038 Data suggest that tissue inhibitor of metalloproteinases-1 (TIMP-1) activates Ras, which then turns on the ERK and phosphatidylinositol 3-kinase signaling pathways to promote cell cycle progression of human aortic smooth muscle cells.
15363818 TIMP-1 may be a key mediator of left ventricular diastolic dysfunction through definition of ventricular matrix composition.
15363817 Circulating pretreatment MMP-9 and TIMP-1 levels were significantly higher in patients with hypertension
15313474 HBV affects the malignance of hepatocellular cancer by suppressing TIMP-1.
15287862 TIMP-1 concentration in hepatocellular carcinoma was higher than in non-neoplastic liver and correlated with the differentiation grade
15277439 Plasma levels are increased in type 2 diabetic patients.
15248826 marked difference in MMPs and their inhibitors in the in vitro fertilized women and normally ovulating women
15225209 Dermal wound healing in red Duroc pigs show unique mRNA expression of HSP47,BMP-1,TIMP1-3 and hypercontracted,hyperpigmented scars.
15161657 STAT3 directly contributes to the high level of TIMP1 expression in anaplastic lymphoma kinase-positive anaplastic large cell lymphoma.
15073104 TIMP-1 may have a role in progression of primary breast cancer
15051730 TIMP1 gene transcription is regulated by RUNX1 and RUNX2
15028476 TIMP-1 expression correlated with pT stage & was an independent predictor of cause-specific survival. TIMP-1 may influence survival through its effects on tumor proliferation, angiogenesis, and tumor invasion.
14983226 MMP-2, TIMP-1 and TIMP-2 are downregulated in human orthotopic liver transplantation
14973177 MMP and TIMP may be involved in the feto-neonatal development and may contribute to the pathogenesis of bronchopulmonary dysplasia and/or intraventricular hemorrhage in critically ill preterm neonates
14962256 TIMP-1 could promote growth of Hodgkin's lymphoma, and may be linked to connective tissue turnover in the nodular sclerosis subtype.
14871825 TIMP-1 is an important contributor to epithelial neoplastic progression and exerts differential regulation on tissues in a stage-dependent manner.
14734567 the pivotal residue of TIMP-1 in metalloproteinase recognition is threonine 98
14710472 Tissue from lateral and medial rectus muscles had different levels of expression of TIMP-1 and 2, MMP-2, and BMP-4,which may underlie different characteristics of these extraocular muscles and may influence wound healing after strabismus surgery.
14688084 blocks transmigration of granulocytes into urine; entrapped and activated granulocytes, protected from apoptosis, might destroy renal parenchyma and contribute to the pathogenesis of renal scarring following acute pyelonephritis
14669348 Overexpressed in ulcerative colitis and serve as biological markers.
14661256 effect of titanium, zirconia and alumina ceramics on activity and secretion in human osteoblasts
14652000 These findings demonstrate that the ability of TIMP-1 to inhibit apoptosis in T-47D cells is mediated by the sequential activation of pertussis toxin-sensitive G protein, c-Src, PI3 kinase, and Akt.
14648584 Authors of this review propose that astrocyte-TIMP-1 may play an important role in central nervous system homeostasis and disease.
14622947 exhibits keratinocyte and fibroblast growth factor-like activity and has been described as a cell survival factor in skin
14605322 Observational study of gene-disease association. (HuGE Navigator)
14605322 Our analysis of the entire coding region of TIMP-1, -2, and -3, which are the main inhibitors of metalloproteinase activity in the extracellular matrix, failed to show an association between genetic polymorphisms and an intracranial aneurysm
14517716 A bivariate analysis revealed a strong and highly significant correlation between TIMP-1 and TGF-beta1, which was due to common genetic and environmental sources.
12970724 Palpable tumours (T2, T3) expressed significantly more MMP-2 and significantly less MMP-9 than T1c tumours
12951656 In diseased brain the ability of astrocytes to counteract the destructive effects of MMP through expression of TIMP-1 is diminished by chronic activation. Our studies reveal new opportunities for therapeutics in HIV-associated dementia
12921631 Imbalanced ratio of TIMP-1:MMP-9 may not only play a role in the pathogenesis of COPD, but also relate to FEV(1.0)% of prediction and RV/TLC%.
12904305 anti-apoptotic effects of TIMP-1 in human breast epithelial cells through TIMP-1-specific signal transduction pathways
12873541 Patients with deteriorating heart failure have increased expression of TIMP1 and MMP1 mRNA. Correlation with pro-inflammatory cytokines suggests common pathways of regulation and potential activation by IL-6 and IL1-beta.
12869573 threonine 98 is critical in initiating MT1-MMP binding and complex stabilization
12861139 study suggested that, in fibroblasts that were derived from the continent woman, tissue inhibitor of metalloproteinase 1 protein production increases with increasing estrogen levels and that, in stress incontinent fibroblasts, no similar increase occurs
12846741 STAT1 and STAT3 may, at least in part, mediate angiotensin II-induced TIMP-1 mRNA expression in human renal proximal tubular epithelial cells, implicating a role of the STAT signaling pathway in pathogenesis of renal tubulointerstitial fibrosis.
12791318 multiple roles of MMP-9 and TIMP-1 in progress of inflammation and tissue damage and/or in repair, depending on clinical stages of SLE
12771930 IL-10 receptor signaling of TIMP-1 expression is regulated by tyrosine phosphorylation of a novel gene (IL-10E1) in human prostate cells
12717827 The interaction between MMP-9 and TIMP-1 in the processes of gastric tumor invasion and metastasis is that MMP-9 mainly promotes tumor invasion and metastasis and TIMP-1 inhibits functions of MMP-9.
12704667 TIMP-1 has a role in inhibiting tumor growth by angiogenesis suppression
12651627 expression and regulation by intestinal myofibroblasts in inflammatory bowel disease
12634064 N-TIMP-1 interaction with the catalytic domain of MMP-3 investigation by titration calorimetry and 15N NMR
12626459 TIMP-1 protein levels were significantly elevated among Kawasaki disease patients, compared to those of febrile and afebrile controls
12620441 Significantly lower expression of tissue inhibitor of matrix metalloproteinase-1 was found in follicular fluid of female patients with polycystic ovary syndrome compared with normally ovulating patients
12614934 Levels of TIMP-1 were significantly elevated in cerebrospinal fluid samples from all disease groups: Parkinson's, amyotrophic lateral sclerosis, and Huntington's and Alzheimer's disease.
12612199 association between TIMP-1 and the process of renal scarring in pyelonephritis
12538453 TIMP1 may have a role in the pathogenesis of papillary thyroid carcinoma
12496489 TIMP-1 expression is regulated by IL-10 and IL-10 receptor signaling in primary human prostate tumor cell lines.
12479097 The over-expression of MMP-2, MMP-9, TIMP-1, and TIMP-2 may play a key role in invasion and lymph-node metastasis in squamous carcinoma of the cervix.
12475252 Progress curve analysis of MMP inhibition by TIMP-1 shows that it has lower reactivity with MMPs at less acidic conditions than TIMP-4.
12452001 the association between the positive expression of TIMP-1 and the invasiveness and metastasis was negative.
12406369 This protein is present in normal and azoospermic human semen.
12376362 MMP-9 level and TIMP-1 levels increased after birth but are not linked to bronchopulmonary dysplasia outcome; low MMP-2 level at birth is associated with the development of BPD
12218659 Observational study of gene-disease association. (HuGE Navigator)
12218659 polymorphisms and cerebrospinal fluid levels of this protein in sporadic Alzheimer's disease
12150976 enhancement of TIMP-1 is associated with suppression of prostate neoplasm invasiveness caused by staurosporine treatment
12147251 role in activating ras proteins
12082592 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
12081564 TIMP-1 inhibits the serum deprivation-induced apoptosis in rat mesangial cells, in which Bax might be involved.
12063180 Regulation of TIMP-1 phenotypic expression in Epstein--Barr virus-immortalized B lymphocytes.
12034345 TIMP-1 was intensively detected in both stromal and epithelial cells in the menstrual period but the expression decreased in other stages of the menstrual cycle.
12032189 elevation of serum and urine levels in patients with kidney diseases
11940298 TIMP-1 expression was increased notably in partially sclerotic glomeruli, and most prominently expressed in tubulointerstitium, mainly in tubular epithelial cells, interstitial cells, and vascular endothelial cells.
11935340 Variability of X chromosome inactivation: effect on levels of TIMP1 RNA and role of DNA methylation.
11876751 The role of TIMPs and MMPs in the pathogenesis of atopic dermatitis was studied by evaluating serum levels of TIMP-1 and MMP-3 in AD and controls. TIMP-1 was significantly higher in AD during exacerbation than in nonatopic subjects, but MMP-3 was not.
11796725 inhibition of apoptosis of activated hepatic stellar cells mediated via effects on matrix metalloproteinase inhibition
11762702 17beta-estradiol had no influence on production in MG-63 cells or human osteoblast cultures
11705862 All patient groups had higher urinary TIMP-1 concentrations than healthy volunteers.
11606052 The growth of the primary melanoma cell lines was stimulated by TIMP-1 and inhibited by TIMP-2. In contrast, the growth of the visceral metastatic melanoma cell line was stimulated by TIMP-2.
11598182 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of TIMP metallopeptidase inhibitor 1 (TIMP1) expression by HIV-1 Vpr in Vpr transduced macrophages
8757599 A stable-isotope labeling by amino acids in cell culture coupled with mass spectrometry-based proteomics identifies upregulation of TIMP metallopeptidase inhibitor 1 (TIMP1) expression by HIV-1 Vpr in Vpr transduced macrophages

AA Sequence

MAPFEPLASGILLLLWLIAPSRACTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYK      1 - 70
GFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFT     71 - 140
KTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA       141 - 207
//

Text Mined References (548)

PMID Year Title
27089280 2016 Evaluation of New Diagnostic Biomarkers in Pediatric Sepsis: Matrix Metalloproteinase-9, Tissue Inhibitor of Metalloproteinase-1, Mid-Regional Pro-Atrial Natriuretic Peptide, and Adipocyte Fatty-Acid Binding Protein.
26973196 [Reference ranges of matrix metalloproteinase-1, -2, -9 and tissue inhibitor of matrix metalloproteinases-1 concentrations in amniotic fluid in physiological pregnancy].
26861446 2016 Metformin improves the angiogenic potential of human CD34? cells co-incident with downregulating CXCL10 and TIMP1 gene expression and increasing VEGFA under hyperglycemia and hypoxia within a therapeutic window for myocardial infarction.
26856083 2015 [MATRIX METALLOPROTEINASE 9 AND TISSUE INHIBITOR OF MATRIX METALLOPROTEINASES TYPE 1 SERUM CONCENTRATIONS AND GENETIC POLYMORPHISM IN SENILE AORTIC STENOSIS].
26844501 2016 Associations of Matrix Metalloproteinase-9 and Tissue Inhibitory Factor-1 Polymorphisms With Parkinson Disease in Taiwan.
26782559 2015 Expression profiles of MMP-1 and TIMP-1 in lumbar intervertebral disc degeneration.
26782378 2015 Effect of TIMP1 transfection on PTEN expression in human kidney proximal tubular cells.
26730601 2016 Serum Biomarkers Associated with Clinical Outcomes Fail to Predict Brain Metastases in Patients with Stage IV Non-Small Cell Lung Cancers.
26722039 2016 Association of Tissue Inhibitor of Metalloproteinase-1 Genotypes with Lung Cancer Risk in Taiwan.
26718740 2016 Activation of Toll-like receptor 7 regulates the expression of IFN-?1, p53, PTEN, VEGF, TIMP-1 and MMP-9 in pancreatic cancer cells.
26681056 2015 Regulating effect of MMP-9 and TIMP-1 in pituitary adenoma invasion.
26626455 2016 Association of MMP-9 to TIMP-1 ratio with long-term body weight and waist circumference after dietary weight reduction in men with metabolic syndrome.
26539028 2015 TIMP1, TIMP2, and TIMP4 are increased in aqueous humor from primary open angle glaucoma patients.
26490574 2016 Diagnostic value of matrix metalloproteinase 9 and tissue inhibitor of matrix metalloproteinases 1 in cholesteatoma.
26399271 2015 Diagnostic Value of Matrix Metalloproteinase-9 and Tissue Inhibitor of Matrix Metalloproteinase-1 in Sepsis-Associated Acute Kidney Injury.
26366732 2015 TIMP-1 Inhibits Apoptosis in Lung Adenocarcinoma Cells via Interaction with Bcl-2.
26329758 2015 Tissue Inhibitors of Metalloproteinase-1 and 2 and Obesity Related Non-Alcoholic Fatty Liver Disease: Is There a Relationship.
26268417 2016 Increased expression of metalloproteinase-2 and -9 (MMP-2, MMP-9), tissue inhibitor of metalloproteinase-1 and -2 (TIMP-1, TIMP-2), and EMMPRIN (CD147) in multiple myeloma.
26254391 2015 Plasma TIMP-1 and CEA as Markers for Detection of Primary Colorectal Cancer: A Prospective Validation Study Including Symptomatic and Non-symptomatic Individuals.
26213230 2015 The tissue inhibitor of metalloproteinases 1 increases the clonogenic efficiency of human hematopoietic progenitor cells through CD63/PI3K/Akt signaling.
26197083 2015 MMP, VEGF and TIMP as prognostic factors in recurring bladder cancer.
26193199 2015 Prognostic significance of MMP-9 and TIMP-1 in liver metastases.
26168159 2015 Tissue Inhibitor Of Matrix Metalloproteinase-1 Is Required for High-Fat Diet-Induced Glucose Intolerance and Hepatic Steatosis in Mice.
26120586 2015 Altered Expression Levels of MMP1, MMP9, MMP12, TIMP1, and IL-1? as a Risk Factor for the Elevated IOP and Optic Nerve Head Damage in the Primary Open-Angle Glaucoma Patients.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26077878 2015 Prognosis of new-onset heart failure outpatients and collagen biomarkers.
26002577 2015 Serum markers in early-stage and locally advanced melanoma.
25998046 2015 MicroRNA-377 predicts poor clinical outcome of gastric cancer and induces tumorigenesis by targeting multiple tumor-suppressor genes.
25951835 2015 Resistance of MMP9 and TIMP1 to endotoxin tolerance.
25932641 2015 Association of MMP-9 Haplotypes and TIMP-1 Polymorphism with Spontaneous Deep Intracerebral Hemorrhage in the Taiwan Population.
25895516 2015 TIMP-1 Induces ?-Smooth Muscle Actin in Fibroblasts to Promote Urethral Scar Formation.
25868389 2015 Identification of new biomarkers for human papillary thyroid carcinoma employing NanoString analysis.
25854270 2015 Tissue inhibitor of metalloproteinase-1 is responsible for residual pleural thickening in pleural tuberculosis.
25765004 2015 Novel expression and regulation of TIMP-1 in Epstein Barr virus-infected cells and its impact on cell survival.
25756591 2015 TIMP-1 overexpression in lung carcinoma enhances tumor kinetics and angiogenesis in brain metastasis.
25712810 2015 Elevated matrix metalloproteinase-8 in saliva and serum in polycystic ovary syndrome and association with gingival inflammation.
25693084 2014 Diagnostic significance of TIMP-1 level in serum and its immunohistochemical expression in colorectal cancer patients.
25674294 2014 Immunohistochemical expression of matrix metalloproteinase-9 and inhibitor of matrix metalloproteinase-1 in prostate adenocarcinoma.
25665057 2015 TIMP-1 inhibition of occludin degradation in Caco-2 intestinal cells: a potential protective role in necrotizing enterocolitis.
25623427 2015 Targeting TR4 nuclear receptor suppresses prostate cancer invasion via reduction of infiltrating macrophages with alteration of the TIMP-1/MMP2/MMP9 signals.
25608838 2015 TIMP-1 and CEA as biomarkers in third-line treatment with irinotecan and cetuximab for metastatic colorectal cancer.
25594187 2016 Tissue inhibitor of matrix metalloproteinase-1 expression in colorectal cancer liver metastases is associated with vascular structures.
25578494 2015 Down-regulation of TIMP-1 inhibits cell migration, invasion, and metastatic colonization in lung adenocarcinoma.
25549087 2014 MiR-29a reduces TIMP-1 production by dermal fibroblasts via targeting TGF-? activated kinase 1 binding protein 1, implications for systemic sclerosis.
25532000 2014 TIMP-1 expression in human colorectal cancer is associated with SMAD3 gene expression levels: a pilot study.
25470608 2015 Expression of vascular endothelial factor-A, gelatinases (MMP-2, MMP-9) and TIMP-1 in uterine leiomyomas.
25470073 2015 Urinary Emmprin, matrix metalloproteinase 9 and tissue inhibitor of metalloproteinase 1 as potential biomarkers in children with ureteropelvic junction narrowing on conservative treatment.
25466591 2014 Genetic susceptibility of early aseptic loosening after total hip arthroplasty: the influence of TIMP-1 gene polymorphism on Chinese Han population.
25436070 2014 Role of matrix metalloproteinase (MMP) 2 and MMP-9 in soft tissue sarcoma.
25407832 2014 Diagnostic and prognostic value of neutrophil gelatinase-associated lipocalin, matrix metalloproteinase-9, and tissue inhibitor of matrix metalloproteinases-1 for sepsis in the Emergency Department: an observational study.
25360794 2015 Circular trimers of gelatinase B/matrix metalloproteinase-9 constitute a distinct population of functional enzyme molecules differentially regulated by tissue inhibitor of metalloproteinases-1.
25335732 2014 Clinical implications of proteolytic activity imbalance in breast cancer diagnosis.
25316052 2015 Evaluation in pre-diagnosis samples discounts ICAM-1 and TIMP-1 as biomarkers for earlier diagnosis of pancreatic cancer.
25300296 2014 Overexpression of matrix metalloproteinases in lung tissue of patients with primary spontaneous pneumothorax.
25263437 2015 Tissue inhibitor of metalloproteinases-1 induces a pro-tumourigenic increase of miR-210 in lung adenocarcinoma cells and their exosomes.
25233933 2014 OncomiR-196 promotes an invasive phenotype in oral cancer through the NME4-JNK-TIMP1-MMP signaling pathway.
25183545 2014 Small GTPase Rab37 targets tissue inhibitor of metalloproteinase 1 for exocytosis and thus suppresses tumour metastasis.
25153995 2014 Overexpression of MMP-9 and its inhibitors in blood mononuclear cells after myocardial infarction--is it associated with depressive symptomatology?
25137018 2014 Urinary TIMP-1 and MMP-2 levels detect the presence of pancreatic malignancies.
25128867 2014 Association of tissue inhibitor of metalloproteinase gene polymorphisms and unexplained recurrent spontaneous abortions in Han Chinese couples.
25016699 2014 The measurement of circulating matrix metalloproteinase-8 and its tissue inhibitor and their association with inflammatory mediators in patients with acute coronary syndrome.
24986570 2014 Imbalance between MMP-2, 9 and TIMP-1 promote the invasion and metastasis of renal cell carcinoma via SKP2 signaling pathways.
24976505 2014 Cannabinoids inhibit angiogenic capacities of endothelial cells via release of tissue inhibitor of matrix metalloproteinases-1 from lung cancer cells.
24913092 2014 Tissue inhibitor of matrix metalloproteinase-1 polymorphism, plasma TIMP-1 levels, and antihypertensive therapy responsiveness in hypertensive disorders of pregnancy.
24895412 2014 TIMP-1 via TWIST1 induces EMT phenotypes in human breast epithelial cells.
24819588 2015 Mesenchymal stem cells inhibit breast cancer cell migration and invasion through secretion of tissue inhibitor of metalloproteinase-1 and -2.
24728097 2014 Association between serum tissue inhibitor of matrix metalloproteinase-1 levels and mortality in patients with severe brain trauma injury.
24727739 2014 Association of sepsis-related mortality with early increase of TIMP-1/MMP-9 ratio.
24651234 2014 Serum MMP-8 and TIMP-1 in critically ill patients with acute respiratory failure: TIMP-1 is associated with increased 90-day mortality.
24635319 2014 TIMP-1 modulates chemotaxis of human neural stem cells through CD63 and integrin signalling.
24479343 [Matrix metalloproteinases (MMP)--MMP-1,-2,-9 and its endogenous activity regulators in transformed by E7 oncogene HPV16 and HPV18 cervical carcinoma cell lines].
24457057 2014 A four-marker signature of TNF-RII, TGF-?, TIMP-1 and CRP is prognostic of worse survival in high-risk surgically resected melanoma.
24447332 2014 MMP-2 and TIMP-1 predict healing of WTC-lung injury in New York City firefighters.
24442990 2014 Correlation of matrix metalloproteinases-1 and tissue inhibitor of metalloproteinases-1 with patient age and grade of lumbar disk herniation.
24427345 2014 Upregulated TIMP-1 correlates with poor prognosis of laryngeal squamous cell carcinoma.
24389602 2014 The role of urinary TIMP1 and MMP9 levels in predicting vesicoureteral reflux in neonates with antenatal hydronephrosis.
24347177 2014 The activation of TLR7 regulates the expression of VEGF, TIMP1, MMP2, IL-6, and IL-15 in Hela cells.
24330623 2013 Plasma levels of the MMP-9:TIMP-1 complex as prognostic biomarker in breast cancer: a retrospective study.
24283658 2014 Matrix metalloproteinase (MMP)-8 and tissue inhibitor of MMP-1 (TIMP-1) gene polymorphisms in generalized aggressive periodontitis: gingival crevicular fluid MMP-8 and TIMP-1 levels and outcome of periodontal therapy.
24212294 2013 Association between serum levels of pro-metalloproteinase 1, tissue inhibitor of metalloproteinases 1 and 2 and prevalent cardiovascular disease in a population-based study.
24174628 2013 Angiogenic capacity of M1- and M2-polarized macrophages is determined by the levels of TIMP-1 complexed with their secreted proMMP-9.
24143225 2013 TIMP-1 promotes accumulation of cancer associated fibroblasts and cancer progression.
24118356 2014 Association of MMP but not TIMP-1 gene polymorphisms with recurrent aphthous stomatitis.
24113427 2014 Activation of extracellular signal-regulated kinase 1/2 and Sp1 may contribute to the expression of tissue inhibitor of metalloproteinases-1 induced by transforming growth factor-?1 in human pulmonary arterial smooth muscle cells.
24068394 2013 High variability in MMP2/TIMP2 and MMP9/TIMP1 expression in secondary liver tumors.
24042342 2014 siRNA knockdown of tissue inhibitor of metalloproteinase-1 in keloid fibroblasts leads to degradation of collagen type I.
24039251 2013 SIRT1 redresses the imbalance of tissue inhibitor of matrix metalloproteinase-1 and matrix metalloproteinase-9 in the development of mouse emphysema and human COPD.
23998545 2013 Matrix metalloproteinase-9, tissue inhibitor of metalloproteinase-1, B? tenascin-C and ED-A? fibronectin in dilated cardiomyopathy: potential impact on disease progression and patients' prognosis.
23993112 2013 Correlation of bacterial coinfection versus matrix metalloproteinase 9 and tissue inhibitor of metalloproteinase 1 expression in aortic aneurysm and atherosclerosis.
23982756 2014 Cytokine functions of TIMP-1.
23967215 2013 Natural haemozoin induces expression and release of human monocyte tissue inhibitor of metalloproteinase-1.
23962148 2013 Prognostic value of serum MMP-8, -9 and TIMP-1 in patients with hepatocellular carcinoma.
23909892 2013 TIMP-1 increases expression and phosphorylation of proteins associated with drug resistance in breast cancer cells.
23900236 2013 Modulation of u-PA, MMPs and their inhibitors by a novel nutrient mixture in pediatric human sarcoma cell lines.
23893334 2013 In papillary thyroid carcinoma, TIMP-1 expression correlates with BRAF (V600E) mutation status and together with hypoxia-related proteins predicts aggressive behavior.
23881388 2013 TIMP1 overexpression mediates resistance of MCF-7 human breast cancer cells to fulvestrant and down-regulates progesterone receptor expression.
23841813 2014 TIMP-1 polymorphisms in a Chinese Han population with intracerebral hemorrhage.
23834019 2013 Tissue inhibitor of metalloproteinase 1 (TIMP-1) as a biomarker in gastric cancer: a review.
23817219 2013 Temporal profile of matrix metalloproteinases and their inhibitors in a human endothelial cell culture model of cerebral ischemia.
23815085 2013 The presence of outer arm fucose residues on the N-glycans of tissue inhibitor of metalloproteinases-1 reduces its activity.
23773968 2013 Serum tissue inhibitor of metalloproteinase 1 (TIMP-1) and vascular endothelial growth factor A (VEGF-A) are associated with prognosis in esophageal cancer patients.
23768069 2013 The estimation of metaloproteinases and their inhibitors blood levels in patients with pancreatic tumors.
23763354 2013 Discovery, synthetic methodology, and biological evaluation for antiphotoaging activity of bicyclic[1,2,3]triazoles: in vitro and in vivo studies.
23706069 2013 The 372 T/C genetic polymorphism of TIMP-1 is associated with serum levels of TIMP-1 and survival in patients with severe sepsis.
23673111 2013 Correlations between papillary thyroid cancer and peripheral blood levels of matrix metalloproteinase-2, matrix metalloproteinase-9, tissue inhibitor of metalloproteinase-1, and tissue inhibitor of metalloproteinase-2.
23661104 2013 Gelatinases and their tissue inhibitors in a group of subjects with metabolic syndrome.
23660069 2013 The tissue inhibitor of metalloproteinases-1 improves migration and adhesion of hematopoietic stem and progenitor cells.
23650722 [Interstitial collagenase, gelatinases A and B and their endogenous inhibitors in squamous cell cervical carcinomas].
23592002 2013 Tissue inhibitor of metalloproteinases-1 as a biological marker in colorectal cancer: influence of smoking on plasma levels?
23585206 2013 Concentration of gelatinases and their tissue inhibitors in pancreatic inflammatory and neoplastic tumors and their influence on the early postoperative course.
23583449 2013 A crucial role for Lyn in TIMP-1 erythroid cell survival signalling pathway.
23563628 2013 Association of TIMP-1 and TIMP-2 gene polymorphisms with progression of liver fibrosis in patients with type C chronic liver disease.
23557756 2013 Altered circulating levels of matrix metalloproteinases 2 and 9 and their inhibitors and effect of progesterone supplementation in women with endometriosis undergoing in vitro fertilization.
23555182 2013 ERK2-regulated TIMP1 induces hyperproliferation of K-Ras(G12D)-transformed pancreatic ductal cells.
23548070 2013 Clinical utility of measuring expression levels of KAP1, TIMP1 and STC2 in peripheral blood of patients with gastric cancer.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23525523 2013 Interleukin-33, matrix metalloproteinase-9, and tissue inhibitor [corrected] of matrix metalloproteinase-1 in myocardial infarction.
23522389 2013 Timp1 interacts with beta-1 integrin and CD63 along melanoma genesis and confers anoikis resistance by activating PI3-K signaling pathway independently of Akt phosphorylation.
23509357 2013 Inflammation induced by MMP-9 enhances tumor regression of experimental breast cancer.
23457635 2013 Extracellular regulated kinase 1/2 signaling is a critical regulator of interleukin-1?-mediated astrocyte tissue inhibitor of metalloproteinase-1 expression.
23412981 2013 Matrix metalloproteinases-2, -3 and tissue inhibitors of metalloproteinases-1, -2 in placentas from preterm pregnancies and their association with one-carbon metabolites.
23407481 2013 Serum osteopontin and tissue inhibitor of metalloproteinase 1 as diagnostic and prognostic biomarkers for pancreatic adenocarcinoma.
23388475 2012 Concentrations and activities of metalloproteinases 2 and 9 and their inhibitors (TIMPS) in chronic pancreatitis and pancreatic adenocarcinoma.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23318123 2013 The TIMP-1 expression in germinal centers of hypertrophied adenoids in children.
23223421 2013 Toll-like receptor-mediated, enhanced production of profibrotic TIMP-1 in monocytes from patients with systemic sclerosis: role of serum factors.
23179318 2013 Subsequent gene expression pattern in dendritic cells following multiple trauma.
23175213 2013 Gambogic acid inhibits invasion of osteosarcoma via upregulation of TIMP-1.
23158994 2012 [Significance of TIMP-1 and nm-23 expressions in HER-2-positive breast cancer].
23122949 2013 Leukemia inhibitory factor increases the invasiveness of trophoblastic cells through integrated increase in the expression of adhesion molecules and pappalysin 1 with a concomitant decrease in the expression of tissue inhibitor of matrix metalloproteinases.
23107442 2012 Serum levels of tissue inhibitor of metalloproteinase-1 are correlated with liver fibrosis in patients with chronic hepatitis B.
23064462 2013 Matrix metalloproteinases and their impact on sinusal extension in chronic rhinosinusitis with nasal polyps.
23060593 2012 Plasma TIMP1 level is a prognostic factor in patients with liver metastases.
23057632 2012 Expression of MMP-2 and TIMP-1 in renal tissue of patients with chronic active antibody-mediated renal graft rejection.
23043898 2013 Differences in MMPs and TIMP-1 expression between intervertebral disc and disc herniation.
23016931 2012 Nitric oxide-mediated regulation of ?-amyloid clearance via alterations of MMP-9/TIMP-1.
22985578 2012 [Correlation of the expressions of MMPs-9, TIMP-1 and TIMP-2 with cesarean section scar].
22975753 2013 Serum proteins reflecting inflammation, injury and repair as biomarkers of disease activity in ANCA-associated vasculitis.
22971139 2012 The association between levels of tissue inhibitor of metalloproteinase-1 with acute heart failure and left ventricular dysfunction in patients with ST elevation myocardial infarction treated by primary percutaneous coronary intervention.
22965799 2012 Overgrowth with increased proliferation of fibroblast and matrix metalloproteinase activity related to reduced TIMP1: a newly recognized syndrome?
22957045 2012 Nitric oxide synthase and breast cancer: role of TIMP-1 in NO-mediated Akt activation.
22906271 2012 Levels of matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 mRNAs in patients with primary hypertension or hypertension-induced atherosclerosis.
22905912 2012 Resveratrol-induced changes of the human adipocyte secretion profile.
22901654 2012 Expression of MMP-1 and TIMP-1 in irradiated mandibles during distraction osteogenesis.
22883459 2012 [Expression and significance of matrix metalloproteinase and tissue inhibitor of matrix metalloproteinase in non-melanoma skin cancer].
22859303 2012 Overexpression and ?-1,6-N-acetylglucosaminylation-initiated aberrant glycosylation of TIMP-1: a "double whammy" strategy in colon cancer progression.
22820628 2012 Association of TIMP-1 +372 SNP with digital ulcer manifestation in female systemic sclerosis patients.
22788708 2013 Prognostic value of serum PIIINP, MMP1 and TIMP1 levels in hypertensive patients: a community-based prospective cohort study.
22739984 2012 Tissue inhibitor of metalloproteinases-1 protects human neurons from staurosporine and HIV-1-induced apoptosis: mechanisms and relevance to HIV-1-associated dementia.
22718114 2012 The endogenous protease inhibitor TIMP-1 mediates protection and recovery from cutaneous photodamage.
22712305 [Morphological features of placenta and expression of collagen-6, MMP-1 and TIMP-1 in placental membranes of women with premature rupture of membranes].
22706255 2012 Serum MMP-9 and TIMP-1 concentrations and MMP-9 activity during surgery-induced inflammation in humans.
22671570 2012 MMP3 and TIMP1 variants contribute to chronic periodontitis and may be implicated in disease progression.
22667130 2012 [To study of the nasal mucosa remodeling of allergic rhinitis patients].
22645431 2012 Expressions of MMPs and TIMP-1 in gastric ulcers may differentiate H. pylori-infected from NSAID-related ulcers.
22558080 2012 Recombinant GPI-anchored TIMP-1 stimulates growth and migration of peritoneal mesothelial cells.
22547904 2012 Concentration kinetics of serum MMP-9 and TIMP-1 after blunt multiple injuries in the early posttraumatic period.
22544540 2012 High expression of TIMP-1 in human breast cancer tissues is a predictive of resistance to paclitaxel-based chemotherapy.
22532131 2012 The role of matrix metalloproteinases (MMPs) and their inhibitors (TIMPs) in the development of esophageal cancer.
22516898 2012 Local and systemic expressions of MMP-9, TIMP-1 and PAI-1 in patients undergoing surgery for clinically suspected appendicitis.
22465225 2012 Tumor tissue inhibitor of metalloproteinases-1 (TIMP-1) in hormone-independent breast cancer might originate in stromal cells, and improves stratification of prognosis together with nodal status.
22457727 2012 RUNX3 mediates suppression of tumor growth and metastasis of human CCRCC by regulating cyclin related proteins and TIMP-1.
22427646 2012 Matrix metalloproteinase-10 (MMP-10) interaction with tissue inhibitors of metalloproteinases TIMP-1 and TIMP-2: binding studies and crystal structure.
22402936 2012 Imbalanced matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 activities in patients with thromboangiitis obliterans.
22397869 2012 Is tissue inhibitor of metalloproteinase-1 a new prognosticator for breast cancer? An analysis of 266 cases.
22364921 2012 Thymic stromal lymphopoietin downregulates NME1 expression and promotes invasion in human trophoblasts via the activation of STAT3 signaling pathway.
22305865 2012 Intraluminal thrombus has a selective influence on matrix metalloproteinases and their inhibitors (tissue inhibitors of matrix metalloproteinases) in the wall of abdominal aortic aneurysms.
22291969 2012 Inhibition of histone deacetylase activity in human endometrial stromal cells promotes extracellular matrix remodelling and limits embryo invasion.
22289852 2012 Increased MMP-9 and TIMP-1 in mouse neonatal brain and plasma and in human neonatal plasma after hypoxia-ischemia: a potential marker of neonatal encephalopathy.
22286923 2012 Differential gene expression of MMP-1, TIMP-1 and HGF in clinically involved and uninvolved skin in South Africans with SSc.
22257687 2013 The balance of serum matrix metalloproteinase-8 and its tissue inhibitor in acute coronary syndrome and its recurrence.
22223664 2012 Tissue inhibitor of metalloproteinase-1 (TIMP-1) regulates mesenchymal stem cells through let-7f microRNA and Wnt/?-catenin signaling.
22204652 2011 Novel association patterns of cardiac remodeling markers in patients with essential hypertension and atrial fibrillation.
22200710 2011 [Expression of MMP-2 and TIMP-1 in renal tissues of patients with chronic active antibody-mediated renal graft rejection].
22200690 2012 Expression of MMP-2, -7, -9, MT1-MMP and TIMP-1 and -2 has no prognostic relevance in patients with advanced epithelial ovarian cancer.
22200256 2012 Metalloproteinases 2 and 9 and their tissue inhibitors 1 and 2 are increased in vulvar lichen sclerosus.
22199358 2012 Tissue inhibitor of metalloproteinases (TIMP-1), genetic markers of insulin resistance and cardiomyopathy in patients with kidney failure.
22177802 2012 uPA and uPAR shRNA inhibit angiogenesis via enhanced secretion of SVEGFR1 independent of GM-CSF but dependent on TIMP-1 in endothelial and glioblastoma cells.
22139647 MMP-9 overexpression due to TIMP-1 and RECK underexpression is associated with prognosis in prostate cancer.
22122951 2011 Biochemical comparison of osteoarthritic knees with and without effusion.
22110238 2011 Prognostic significance of TIMP-1 in non-small cell lung cancer.
22051851 2012 Temporal investigation of matrix metalloproteinases and their inhibitors in human cervicovaginal fluid in late pregnancy and labor.
22020222 2011 Pro-MMP-9/TIMP-1 ratio correlates poorly with a direct assessment of MMP-9 activity.
22016393 2011 Hyaluronan synthase 2 (HAS2) promotes breast cancer cell invasion by suppression of tissue metalloproteinase inhibitor 1 (TIMP-1).
21995626 2011 Salivary tissue inhibitor of metalloproteinases-1 localization and glycosylation profile analysis.
21993004 2011 Tamoxifen lowers the MMP-9/TIMP-1 ratio and inhibits the invasion capacity of ER-positive non-small cell lung cancer cells.
21969093 2012 Matrix metalloproteinase 9 and tissue inhibitor of metalloproteinase 1 in vesicoureteral reflux.
21963718 2011 Thioredoxin stimulates MMP-9 expression, de-regulates the MMP-9/TIMP-1 equilibrium and promotes MMP-9 dependent invasion in human MDA-MB-231 breast cancer cells.
21946941 2012 Expression levels of matrix metalloproteinase (MMP)-9 and its specific inhibitor TIMP-1, in septic and aseptic arthritis of the knee.
21928345 2012 Activity of matrix metallo proteinases (MMPs) and the tissue inhibitor of MMP (TIMP)-1 in electromagnetic field-exposed THP-1 cells.
21903858 2011 BRAFV600E mutation, TIMP-1 upregulation, and NF-?B activation: closing the loop on the papillary thyroid cancer trilogy.
21882477 2011 [Changes of MMP-9 and TIMP-1 levels in gingival crevicular fluid during orthodontic tooth movement under orthodontic forces].
21881840 2012 Expression of matrix metalloproteinase-1, -9, -13, and tissue inhibitor of metalloproteinases-1 in basal cell carcinomas of the eyelid.
21860087 2011 Cerebrospinal fluid matrix metalloproteinases and tissue inhibitor of metalloproteinases in combination with subcortical and cortical biomarkers in vascular dementia and Alzheimer's disease.
21858035 2011 The role of serum biomarkers in predicting fibrosis progression in pediatric and adult hepatitis C virus chronic infection.
21786179 2012 Comparative study of the immunohistochemical expression of tissue inhibitors of metalloproteinases 1 and 2 between clearly invasive carcinomas and "in situ" trophoblast invasion.
21763297 2011 Combinatorial effect of TIMP-1 and ?1AT gene polymorphisms on development of chronic obstructive pulmonary disease.
21745383 2011 Prospective evaluation of serum tissue inhibitor of metalloproteinase 1 and carbonic anhydrase IX in correlation to circulating tumor cells in patients with metastatic breast cancer.
21731773 2011 Mechanism of heparin acceleration of tissue inhibitor of metalloproteases-1 (TIMP-1) degradation by the human neutrophil elastase.
21720458 2011 Rosuvastatin therapy does not affect serum MMP-13 or TIMP-1 levels in hypercholesterolemic patients.
21709637 2011 Association of MMP1-1607 1G/2G and TIMP1 372 T/C gene polymorphisms with risk of primary open angle glaucoma in a Polish population.
21684102 2011 Tissue inhibitor of metalloproteinase-1 decreased chemosensitivity of MDA-435 breast cancer cells to chemotherapeutic drugs through the PI3K/AKT/NF-?B pathway.
21586274 2011 A fine balance between CCNL1 and TIMP1 contributes to the development of breast cancer cells.
21547130 2011 Levels of matrix metalloproteinase-1 and tissue inhibitors of metalloproteinase-1 in gastric cancer.
21535601 Differential effects of sulfated triterpene glycosides, holothurin A1, and 24-dehydroechinoside A, on antimetastasic activity via regulation of the MMP-9 signal pathway.
21524282 2011 Genetic variation in TIMP1 but not MMPs predict excess FEV1 decline in two general population-based cohorts.
21506705 2011 Expression of insulin-like growth factor-II, matrix metalloproteinases, and their tissue inhibitors as predictive markers in the peripheral blood of HCC patients.
21487066 2011 Plasma markers for identifying patients with metastatic melanoma.
21463121 2011 Associations between regulators of extracellular matrix and hemostatic factors in hematologic neoplasias.
21454617 2011 Entropy increases from different sources support the high-affinity binding of the N-terminal inhibitory domains of tissue inhibitors of metalloproteinases to the catalytic domains of matrix metalloproteinases-1 and -3.
21437772 2011 Tissue inhibitor of matrix metalloproteinase 1 (TIMP1) controls adipogenesis in obesity in mice and in humans.
21437624 2011 Imbalanced circulating matrix metalloproteinases in polycystic ovary syndrome.
21427648 2011 Circulating matrix metalloproteinases and their inhibitors in inguinal hernia and abdominal aortic aneurysm.
21356369 2011 Nodal signals through activin receptor-like kinase 7 to inhibit trophoblast migration and invasion: implication in the pathogenesis of preeclampsia.
21283828 2011 Biomarkers of extracellular matrix metabolism (MMP-9 and TIMP-1) and risk of stroke, myocardial infarction, and cause-specific mortality: cohort study.
21269460 2011 Initial characterization of the human central proteome.
21211402 2010 [Relationship between 666C > T polymorphism of TIMP-1 and lumbar intervertebral disc degeneration].
21167221 2011 Generation of antibodies recognizing an aberrant glycoform of human tissue inhibitor of metalloproteinase-1 (TIMP-1) using decoy immunization and phage display.
21165404 2010 Matrix metalloproteinases 2, 7, and 9 and tissue inhibitor of metalloproteinases-1 in tumors and serum of patients with ovarian neoplasms.
21163810 2011 Serum angiogenic profile of patients with glioblastoma identifies distinct tumor subtypes and shows that TIMP-1 is a prognostic factor.
21128246 2011 Runx3 suppresses gastric cancer metastasis through inactivation of MMP9 by upregulation of TIMP-1.
21115936 2010 Chemoradiation-induced changes in serum CEA and plasma TIMP-1 in patients with locally advanced rectal cancer.
21094936 2011 Salivary levels of matrix metalloproteinase (MMP)-9 and tissue inhibitor of matrix metalloproteinase (TIMP)-1: a pilot study about the relationship with periodontal status and MMP-9(-1562C/T) gene promoter polymorphism.
21086628 [Expression of matrix metalloproteinases 2 and 9 and their tissue inhibitors 1 and 2 in papillary thyroid cancer: an association with the clinical, morphological and ultrastructural characteristics of a tumor].
21041986 2011 Hypoxia induces FGF2 production by vascular endothelial cells and alters MMP9 and TIMP1 expression in extravillous trophoblasts and their invasiveness in a cocultured model.
20921293 2011 Matrix metalloproteinase levels in the drained dialysate reflect the peritoneal solute transport rate: a multicentre study in Japan.
20889295 2011 A randomized placebo controlled trial of the effect of preoperative statin use on matrix metalloproteinases and tissue inhibitors of matrix metalloproteinases in areas of low and peak wall stress in patients undergoing elective open repair of abdominal aortic aneurysm.
20854182 2010 Assessment of systemic matrix metalloproteinase and their regulator response in children with Helicobacter pylori gastritis.
20853162 2011 Neutrophil gelatinase-associated lipocalin (NGAL) and matrix metalloproteinases as novel stress markers in children and young adults on chronic dialysis.
20838751 2010 Plasma haemoxygenase-1 in coronary artery disease. A comparison with angiogenin, matrix metalloproteinase-9, tissue inhibitor of metalloproteinase-1 and vascular endothelial growth factor.
20798956 2010 TIMP-1 interaction with ?v?3 integrin confers resistance to human osteosarcoma cell line MG-63 against TNF-?-induced apoptosis.
20707923 2010 Matrix metalloproteinase-3 promoter polymorphisms but not dupA-H. pylori correlate to duodenal ulcers in H. pylori-infected females.
20685094 2011 Serum levels of adhesion molecules ICAM-1 and VCAM-1 and tissue inhibitor of metalloproteinases, TIMP-1, are elevated in patients with autoimmune thyroid disorders: relevance to vascular inflammation.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20655547 2010 Elevated plasma levels of tissue inhibitors of metalloproteinase-1 and their overexpression in muscle in human and mouse muscular dystrophy.
20654099 2010 [Comparison of right atrial matrix metalloproteinase expression between patients with unstable angina and myocardial infarction].
20646231 2011 Smoking and matrix metalloproteinases, neutrophil elastase and myeloperoxidase in chronic periodontitis.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20616161 2010 Functional polymorphisms in matrix metalloproteinases-1, -3, -9 are associated with arteriovenous fistula patency in hemodialysis patients.
20595097 2010 Role of tissue inhibitor of metalloproteinases-1 in the development of autoimmune lymphoproliferation.
20587546 2010 Interferon gamma receptor 2 gene variants are associated with liver fibrosis in patients with chronic hepatitis C infection.
20584750 2010 Nitric oxide-mediated invasion in Barrett's high-grade dysplasia and adenocarcinoma.
20556397 2010 The diagnostic value of matrix metalloproteinase 9 (MMP-9) and tissue inhibitor of matrix metalloproteinases 1 (TIMP-1) determination in the sera of colorectal adenoma and cancer patients.
20545310 2010 The intrinsic protein flexibility of endogenous protease inhibitor TIMP-1 controls its binding interface and affects its function.
20545111 2010 [Expression of MMP-9 and TIMP-1 in nasopharyngeal carcinoma and its signification at Xi'an and Shenzhen].
20533294 2010 Change in proteoglycan metabolism is a characteristic of human patellar tendinopathy.
20514432 2010 Expression profile of matrix metalloproteinase-2 and -9 and their endogenous tissue inhibitors in osteonecrotic femoral heads.
20484597 2010 Association of matrix metalloproteinase gene polymorphisms with refractive error in Amish and Ashkenazi families.
20459644 2010 Lack of relationship between TIMP-1 tumour cell immunoreactivity, treatment efficacy and prognosis in patients with advanced epithelial ovarian cancer.
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20450704 2010 [Effects of double-stranded RNA poly(I:C) on matrix metalloproteinase mRNA expression in human nasal polyp epithelial cells].
20423842 2010 [Expression of matrix metalloproteinase-1 and tissue inhibitor of metalloproteinase-1 in human and nude mouse ectopic endometrium and the effect of estrogen and progestin on their expression].
20388222 2010 TIMP-1 and VEGF-165 serum concentration during first-line therapy of ovarian cancer patients.
20371206 2010 Plasma level of tissue inhibitor of matrix metalloproteinase-1 but not that of matrix metalloproteinase-8 predicts survival in head and neck squamous cell cancer.
20361393 2010 Matrix metalloproteinase-1 and tissue inhibitor of metalloproteinases-1 levels in severely obese patients: what is the effect of weight loss?
20305574 2010 Cigarette smoke alters tissue inhibitor of metalloproteinase 1 and matrix metalloproteinase 9 levels in the basolateral secretions of human asthmatic bronchial epithelium in vitro.
20298300 2008 Identification of patients with chronic obstructive pulmonary disease (COPD) by measurement of plasma biomarkers.
20215736 2011 Age- and gender-dependent changes in connective tissue remodeling: physiological differences in circulating MMP-3, MMP-10, TIMP-1 and TIMP-2 level.
20193458 2009 [Pathologic study of expression and significance of matrix metalloproteinases-9, tissue inhibitor of metalloproteinase-1, vascular endothelial growth factor and transforming growth factor beta-1 in papillary carcinoma and follicular carcinoma of thyroid].
20164040 2009 Expression of tissue inhibitors of metalloproteinase 1 (TIMP-1) in gastric cancer tissue.
20111696 Human neutrophil elastase-mediated cleavage sites of MMP-9 and TIMP-1: implications to cystic fibrosis proteolytic dysfunction.
20095885 2010 A novel prognostic index in colorectal cancer defined by serum carcinoembryonic antigen and plasma tissue inhibitor of metalloproteinases-1.
20051489 2010 Differential release of matrix metalloproteinases and tissue inhibitors of metalloproteinases by human granulosa-lutein cells and ovarian leukocytes.
20041335 2010 Expression of metalloproteases and their inhibitors in primary tumors and in local recurrences after mastectomy for breast cancer.
20039537 2009 [Effect of human silicotic alveolar macrophages on expression of matrix metalloproteinase, tissue inhibitor of metalloproteinase and collagen in human lung fibroblasts].
20030715 2010 MMP-9/TIMP-1 imbalance induced in human dendritic cells by Porphyromonas gingivalis.
20021931 2009 [Effects of PPAR-gamma agonist rosiglitazone on MMP-9 and TIMP-1 expression of monocyte-derived macrophages isolated from patients with acute coronary syndrome].
19927649 2009 [Effect of SiO2 on expression of MMP-9/TIMP-1 in human alveolar macrophages in vitro].
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19911067 2009 Correlation of plasma MMP-1 and TIMP-1 levels and the colonic mucosa expressions in patients with ulcerative colitis.
19904223 2010 Profiling pancreatic cancer-secreted proteome using 15N amino acids and serum-free media.
19889076 2009 Host single nucleotide polymorphisms of MMP-9 -1562/TIMP-1 372 have gender differences in the risk of gastric intestinal metaplasia after Helicobacter pylori infection.
19887890 2009 Immunohistochemical study of matrix metalloproteinase 9 and tissue inhibitor of matrix metalloproteinase 1 in benign and malignant breast tissue--strong expression in intraductal carcinomas of the breast.
19875168 2010 mRNA expression of matrix metalloproteinases (MMPs) 2 and 9 and tissue inhibitor of matrix metalloproteinases (TIMPs) 1 and 2 in childhood acute lymphoblastic leukemia: potential role of TIMP1 as an adverse prognostic factor.
19863693 2010 Tissue inhibitor of metalloproteinases-1-induced scattered liver metastasis is mediated by host-derived urokinase-type plasminogen activator.
19814619 2009 The association of MMP-9 enzyme activity, MMP-9 C1562T polymorphism, and MMP-2 and -9 and TIMP-1, -2, -3, and -4 gene expression in lung cancer.
19796534 Elevated levels of MMP-9 and TIMP-1 in the cerebrospinal fluid of neuro-Behçet's disease.
19781774 2010 High levels of serum TIMP-1 correlate with advanced disease and predict for poor survival in patients with multiple myeloma treated with novel agents.
19766963 2009 Serum levels of hyaluronic acid and tissue metalloproteinase inhibitor-1 combined with age predict the presence of nonalcoholic steatohepatitis in a pilot cohort of subjects with nonalcoholic fatty liver disease.
19758569 2009 Genetic polymorphism of the tissue inhibitor of metalloproteinase-1 is associated with an increased risk of endometrial cancer.
19747478 2009 Thrombospondin-1 (TSP-1) up-regulates tissue inhibitor of metalloproteinase-1 (TIMP-1) production in human tumor cells: exploring the functional significance in tumor cell invasion.
19728856 2009 Pre-treatment serum and plasma levels of matrix metalloproteinase 9 (MMP-9) and tissue inhibitor of matrix metalloproteinases 1 (TIMP-1) in gastric cancer patients.
19723899 2009 Association of the X-chromosomal genes TIMP1 and IL9R with rheumatoid arthritis.
19723139 2009 Expression of matrix metalloproteinases MMP-2, MMP-9 and their tissue inhibitors TIMP-1 and TIMP-2 in the epithelium and stroma of salivary gland pleomorphic adenomas.
19717938 [Evaluation of intra-articular collagenase, TIMP-1, and TNF-alpha levels before and after anterior cruciate ligament reconstruction].
19653096 2010 Association between tumor tissue TIMP-1 levels and objective response to first-line chemotherapy in metastatic breast cancer.
19637058 2009 ProMMP-2: TIMP-1 complexes identified in plasma of healthy individuals.
19629003 2009 Clinical significance of the measurements of serum matrix metalloproteinase-9 and its inhibitor (tissue inhibitor of metalloproteinase-1) in patients with pancreatic cancer: metalloproteinase-9 as an independent prognostic factor.
19609944 2010 Tissue inhibitor of metalloproteinase-1 protects MCF-7 breast cancer cells from paclitaxel-induced apoptosis by decreasing the stability of cyclin B1.
19608737 2009 Neutrophil MMP-9 proenzyme, unencumbered by TIMP-1, undergoes efficient activation in vivo and catalytically induces angiogenesis via a basic fibroblast growth factor (FGF-2)/FGFR-2 pathway.
19596921 2009 Expression of MMP-7, MMP-9, TIMP-1 and TIMP-2 mRNA in lung tissue of patients with non-small cell lung cancer (NSCLC) and benign pulmonary disease.
19560452 2009 Prognostic significance of adipocytokines and extracellular matrix activity in heart failure patients with high B-type natriuretic peptide.
19551542 2009 In vitro study of matrix metalloproteinase/tissue inhibitor of metalloproteinase production by mesenchymal stromal cells in response to inflammatory cytokines: the role of their migration in injured tissues.
19524176 2009 Serum levels of MMP-9 and TIMP-1 in primary hypertension and effect of antihypertensive treatment.
19513566 2009 Negative regulation of TIMP1 is mediated by transcription factor TWIST1.
19506087 2009 Glomerular protein levels of matrix metalloproteinase-1 and tissue inhibitor of metalloproteinase-1 are lower in diabetic subjects.
19464975 2010 Matrix metalloproteinases and tissue inhibitors of metalloproteinases in patients with different types of scars and keloids.
19430729 2009 Low expression of tissue inhibitor of metalloproteinases-1 (TIMP-1) in glioblastoma predicts longer patient survival.
19390929 2009 Impact of plasma tissue inhibitor of metalloproteinase-1 on long-term survival in patients with gastric cancer.
19387352 2009 Relations of serum MMP-9 and TIMP-1 levels to left ventricular measures and cardiovascular risk factors: a population-based study.
19383344 2008 TIMP-1 expression in human colorectal cancer is associated with TGF-B1, LOXL2, INHBA1, TNF-AIP6 and TIMP-2 transcript profiles.
19383343 2008 Estradiol-estrogen receptor: a key interplay of the expression of syndecan-2 and metalloproteinase-9 in breast cancer cells.
19383295 2007 Identification of alternatively spliced TIMP-1 mRNA in cancer cell lines and colon cancer tissue.
19358835 2009 Assessment of matrix metalloproteinase (MMP)-2, MMP-8, MMP-9, and their inhibitors, the tissue inhibitors of metalloproteinase (TIMP)-1 and TIMP-2 in obese children and adolescents.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19331801 2009 Evaluation of metalloproteinase 2 and 9 levels and their inhibitors in combined dyslipidemia.
19288452 2009 Evaluation of metalloproteinases 2 and 9 and their inhibitors in physiologic and pre-eclamptic pregnancy.
19246282 2009 [Effects of all-trans retinioic acid and tazarotene on MMP-1 and TIMP-1 expression in cultured human fibroblasts after heat shock].
19141395 2008 Immunohistochemical analysis of MMP-9, MMP-2 and TIMP-1, TIMP-2 expression in the central nervous system following infection with viral and bacterial meningitis.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19134356 2008 [Roles of matrix metalloproteinases and tissue specific inhibitors of metalloproteinases in dentinogenic ghost cell tumor and ghost cell odontogenic carcinoma].
19036126 2008 Imbalance of tissue inhibitors of metalloproteinases (TIMP) - 1 and - 4 serum levels, in patients with inflammatory bowel disease.
19020757 2008 Serous and mucinous ovarian tumors express different profiles of MMP-2, -7, -9, MT1-MMP, and TIMP-1 and -2.
19019896 2009 Genetic polymorphisms of the matrix metalloproteinase-3 (MMP-3) and tissue inhibitors of matrix metalloproteinases-1 (TIMP-1) modulate the development of ankylosing spondylitis.
19012952 2010 Immunohistochemical localization of tissue inhibitor of matrix metalloproteinase-1 (TIMP-1) in human carious dentine.
18984437 Association of carotid artery atherosclerosis with circulating biomarkers of extracellular matrix remodeling: the Framingham Offspring Study.
18945772 2009 Infection with human cytomegalovirus alters the MMP-9/TIMP-1 balance in human macrophages.
18854176 2008 Integrin alphavbeta3-mediated transcriptional regulation of TIMP-1 in a human ovarian cancer cell line.
18850474 2008 Expression of matrix metalloproteinase-9 (MMP-9) and tissue inhibitor of matrix metalloproteinase (TIMP-1) in tissues with a diagnosis of childhood lymphoma.
18787947 2009 TIMP-1 overexpression promotes tumorigenesis of MDA-MB-231 breast cancer cells and alters expression of a subset of cancer promoting genes in vivo distinct from those observed in vitro.
18704317 2008 Expression of MMP-9 and TIMP-1 in lesions of systemic sclerosis and its implications.
18692810 2009 Increased matrix metalloproteinase-2 and tissue inhibitor of metalloproteinase-1 secretion but unaffected invasiveness of endometrial stromal cells in adenomyosis.
18683786 2008 [Relationships between the expressions of intercellular adhesion molecule-1 and tissue inhibitor of metalloproteinase-1 and matrix metalloproteinase-9 in lung tissues of patients with chronic obstructive pulmonary disease].
18645261 2008 A comparative study of tissue inhibitor of metalloproteinases-1 levels in plasma and tumour tissue from patients with primary breast cancer and in plasma from patients with metastatic breast cancer.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18634035 2009 Matrix metalloproteinases and their tissue inhibitors as prognostic indicators for diagnostic and surgical recurrence in Crohn's disease.
18630499 Invasion front-specific overexpression of tissue inhibitor of metalloproteinase-1 in liver metastases from colorectal cancer.
18502033 2008 TIMP1 induces CD44 expression and the activation and nuclear translocation of SHP1 during the late centrocyte/post-germinal center B cell differentiation.
18487063 Hematopoiesis in mice is extremely resilient to wide variation in TIMP/MMP balance.
18477480 2008 Comparative assessment of matrix metalloproteinase (MMP)-2 and MMP-9, and their inhibitors, tissue inhibitors of metalloproteinase (TIMP)-1 and TIMP-2 in preeclampsia and gestational hypertension.
18474748 2008 Atorvastatin does not alter interferon Beta-induced changes of serum matrix metalloproteinase 9 and tissue inhibitor of metalloproteinase 1 in patients with multiple sclerosis.
18395263 2008 Cerebrospinal fluid levels of matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 in subacute sclerosing panencephalitis.
18391843 2008 Bronchoalveolar lavage MMP-9 and TIMP-1 in preschool wheezers and their relationship to persistent wheeze.
18385523 2008 Tissue inhibitor of metalloproteinase-1 moderates airway re-epithelialization by regulating matrilysin activity.
18298349 2008 Serum levels of the osteoprotegerin, receptor activator of nuclear factor kappa-B ligand, metalloproteinase-1 (MMP-1) and tissue inhibitors of MMP-1 levels are increased in men 6 months after acute myocardial infarction.
18292822 2007 TGF superfamily and MMP2, MMP9, TIMP1 genes expression in the endometrium of women with impaired reproduction.
18291374 2008 Human chorionic gonadotropin stimulates matrix metalloproteinases-2 and -9 in cytotrophoblastic cells and decreases tissue inhibitor of metalloproteinases-1, -2, and -3 in decidualized endometrial stromal cells.
18273688 2008 Fibroblasts potentiate blood vessel formation partially through secreted factor TIMP-1.
18236174 2007 Effects of recombinant H2 relaxin on the expression of matrix metalloproteinases and tissue inhibitor metalloproteinase in cultured early placental extravillous trophoblasts.
18217401 2007 Matrix metalloproteinases and their tissue inhibitors in children with chronic hepatitis B treated with lamivudine.
18214300 2007 Matrix metalloproteinases 7 and 9 and their types 1 and 4 tissue inhibitors in tumors and plasma of patients with colorectal cancer.
18159069 2008 Inhibition of cancer cell invasion by cannabinoids via increased expression of tissue inhibitor of matrix metalloproteinases-1.
18063811 2008 Forkhead factor, FOXO3a, induces apoptosis of endothelial cells through activation of matrix metalloproteinases.
18049028 2007 Impact of the metalloproteinase-9/tissue inhibitor of metalloproteinase-1 system on large arterial stiffness in patients with essential hypertension.
18042068 2007 Differential expression of matrix metalloproteinase (MMP)-2, MMP-9 and tissue inhibitor of metalloproteinase (TIMP)-1 and TIMP-2 in non-melanoma skin cancer: implications for tumour progression.
18034264 2008 Differential expression of stromal MMP-1, MMP-9 and TIMP-1 in basal cell carcinomas of immunosuppressed patients and controls.
18025061 2008 Matrix metalloproteinase expression in the ascending aorta and aortic valve.
17998244 2008 Plasma and serum levels of tissue inhibitor of metalloproteinases-1 are associated with prognosis in node-negative breast cancer: a prospective study.
17928006 2008 Roles of matrix metalloproteinase-9 and tissue inhibitors of metalloproteinases 1 in acute encephalopathy following prolonged febrile seizures.
17920311 2008 Candidate gene association studies in abdominal aortic aneurysm disease: a review and meta-analysis.
17899257 2007 Tissue inhibitor of metalloproteinase-1 (TIMP-1) polymorphisms in a Caucasian population with abdominal aortic aneurysm.
17893005 2007 Multiple-polymorphism associations of 7 matrix metalloproteinase and tissue inhibitor metalloproteinase genes with myocardial infarction and angiographic coronary artery disease.
17878270 2008 Functional proteomics study reveals that N-Acetylglucosaminyltransferase V reinforces the invasive/metastatic potential of colon cancer through aberrant glycosylation on tissue inhibitor of metalloproteinase-1.
17786346 2007 Expression of metalloproteinases and their tissue inhibitors in squamous cell laryngeal carcinoma.
17763191 2007 Tissue inhibitor of metalloproteinase-1 levels in plasma from tumour arteries and veins of patients with rectal cancer.
17726014 2007 Myeloperoxidase inactivates TIMP-1 by oxidizing its N-terminal cysteine residue: an oxidative mechanism for regulating proteolysis during inflammation.
17703334 2008 Elevated serum receptor activator of NFkappaB ligand (RANKL), osteoprotegerin (OPG), matrix metalloproteinase (MMP)3, and ProMMP1 in patients with juvenile idiopathic arthritis.
17660250 2007 Constraining specificity in the N-domain of tissue inhibitor of metalloproteinases-1; gelatinase-selective inhibitors.
17634538 2007 TIMP-1 is significantly associated with objective response and survival in metastatic colorectal cancer patients receiving combination of irinotecan, 5-fluorouracil, and folinic acid.
17589947 2007 Role of matrix metalloproteinase, tissue inhibitor of metalloproteinase and tumor necrosis factor-alpha single nucleotide gene polymorphisms in inflammatory bowel disease.
17572998 2007 [Metalloproteinase-9/tissue inhibitor of metalloproteinase-1 in induced sputum in patients with asthma and chronic obstructive pulmonary disease and their relationship to airway inflammation and airflow limitation].
17564313 2004 Expression of matrix metalloproiteinases (MMPs) and tissue inhibitors of metalloproteinases (TIMPs) in hepatocellular carcinoma tissue, compared with the surrounding non-tumor tissue.
17549663 Investigation of tissue inhibitor of metalloproteinases 1 in plasma from colorectal cancer patients and blood donors by surface-enhanced laser desorption/ionization time-of-flight mass spectrometry.
17543340 2008 Prognostic values of matrix metalloproteinase family expression in human colorectal carcinoma.
17493602 2007 Relationship between matrix metalloproteinases/tissue inhibitors of matrix metalloproteinases systems and autoantibody patterns in systemic sclerosis.
17489740 2007 Identification of a novel 82 kDa proMMP-9 species associated with the surface of leukaemic cells: (auto-)catalytic activation and resistance to inhibition by TIMP-1.
17478562 2007 Concentrations of TIMP1 mRNA splice variants and TIMP-1 protein are differentially associated with prognosis in primary breast cancer.
17456311 2007 [The relationship between TGFbeta1 and TIMP-1 and its effects on the diagnosis of hepatic fibrosis].
17409012 2007 Differential expression of matrix metalloproteinases and tissue-derived inhibitors of metalloproteinase in fetal and adult skins.
17380436 2007 The TIMP-1 gene transferred through adenovirus mediation shows a suppressive effect on peritoneal metastases from gastric cancer.
17350093 2007 Expression of matrix metalloproteinase (MMP) and tissue inhibitor of MMP (TIMP) genes in blasts of infant acute lymphoblastic leukemia with organ involvement.
17340613 2007 TIMP-1 regulates cell proliferation by interacting with the ninth zinc finger domain of PLZF.
17301822 2007 Tissue inhibitor of metalloproteinase-1 promotes hematopoietic differentiation via caspase-3 upstream the MEKK1/MEK6/p38alpha pathway.
17299802 2007 Actinobacillus actinomycetemcomitans lipopolysaccharide regulates matrix metalloproteinase, tissue inhibitors of matrix metalloproteinase, and plasminogen activator production by human gingival fibroblasts: a potential role in connective tissue destruction.
17226791 2007 Regulation of matrix metalloproteinases and tissue inhibitors of matrix metalloproteinases by Porphyromonas gingivalis in an engineered human oral mucosa model.
17222415 2007 Divergent associations of tissue inhibitors of metalloproteinases-1 and -2 with the prothrombotic/fibrinolytic state.
17209789 2006 Gingival crevicular fluid matrix metalloproteinase (MMP)-7, extracellular MMP inducer, and tissue inhibitor of MMP-1 levels in periodontal disease.
17205957 2007 Specific changes in plasma concentrations of matrix metalloproteinase-2 and -9, TIMP-1 and TGF-beta1 in patients with distinct types of primary glomerulonephritis.
17202148 2007 Identification of the extracellular matrix (ECM) binding motifs of tissue inhibitor of metalloproteinases (TIMP)-3 and effective transfer to TIMP-1.
17192464 2007 TIMP-1 transgenic mice recover from diabetes induced by multiple low-dose streptozotocin.
17182940 2006 Genes predisposing to rapid aneurysm growth.
17162914 2005 TIMP-1 production in human retinal pigment epithelial cells after laser exposure.
17136882 Association of serum levels of tissue inhibitors of metalloproteinase-1 with clinical outcome in children with biliary atresia.
17114213 2006 Primary tumor levels of tissue inhibitor of metalloproteinases-1 are predictive of resistance to chemotherapy in patients with metastatic breast cancer.
17072372 2006 Suppression effects of human recombinant tissue inhibitor of metalloproteinases-1(TIMP-1) on tumor proliferation using in vivo treatment model of well-differentiated colon cancer cell line, HT29.
17071711 2006 Gelatinases and their tissue inhibitors during human ovulation: increased expression of tissue inhibitor of matrix metalloproteinase-1.
17050530 2007 Crystal structure of the catalytic domain of matrix metalloproteinase-1 in complex with the inhibitory domain of tissue inhibitor of metalloproteinase-1.
17045024 2006 [Changes of matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 in the bronchoalveolar lavage fluid and the serum of patients with idiopathic pulmonary fibrosis].
17012236 2006 A novel mechanism of tissue inhibitor of metalloproteinases-1 activation by interleukin-1 in primary human astrocytes.
17009408 2006 Expression of matrix metalloproteinase-1 and tissue inhibitor of metalloproteinase-1 in ulcerative colitis.
17008230 2006 Matrix-metalloproteinases and their inhibitors are elevated in severe sepsis: prognostic value of TIMP-1 in severe sepsis.
16996520 2007 Serum tissue inhibitor of metalloproteinases-1 and higher risk features of coronary plaque: a volumetric multivessel intravascular ultrasound study.
16960901 2006 Analysis of TIMP-1 gene polymorphisms in Italian sclerodermic patients.
16940985 2006 Clinical impact of MMP and TIMP gene polymorphisms in gastric cancer.
16935611 2006 Evaluation of MMP3 and TIMP1 as candidate genes for high myopia in young Taiwanese men.
16931892 2006 Apolipoprotein E knockout mice over-expressing human tissue inhibitor of metalloproteinase 1 are protected against aneurysm formation but not against atherosclerotic plaque development.
16917503 2006 Identification of CD63 as a tissue inhibitor of metalloproteinase-1 interacting cell surface protein.
16880228 2006 Increased expression of matrix metalloproteinase-9 in the eutopic endometrial tissue of women with endometriosis.
16877361 2006 Signal transducers and activators of transcription-3 up-regulates tissue inhibitor of metalloproteinase-1 expression and decreases invasiveness of breast cancer.
16864898 2006 Circulating total and active metalloproteinase-9 and tissue inhibitor of metalloproteinases-1 in patients with systemic lupus erythomatosus.
16840178 Matrix metalloproteinase-2, -9, and tissue inhibitor of metalloproteinase-1 in patients with hypertension.
16786122 2006 The role of matrix metalloproteinases and tissue inhibitors of matrix metalloproteinase in microcystic meningiomas.
16772717 2006 Serum levels of matrix metalloproteinases-2 and -9 and their tissue inhibitors in inflammatory neuromuscular disorders.
16767366 2006 Protein levels of tissue inhibitor of metalloproteinase-1 in tumor extracts as a marker for prognosis and recurrence in patients with gastric cancer.
16754484 Levels of matrix metalloproteinase-9 and its inhibitor in bronchoalveolar lavage cells of asthmatic children.
16740002 2006 Identification of N-linked glycoproteins in human saliva by glycoprotein capture and mass spectrometry.
16631927 2006 Tissue inhibitors of metalloproteinases-1 (TIMP-1) and -2(TIMP-2) are major serum factors that stimulate the TIMP-1 gene in human gingival fibroblasts.
16615041 Matrix metalloproteinase-9,-3 and tissue inhibitor of matrix metalloproteinase-1 in colorectal cancer: relationship to clinicopathological variables.
16555295 2006 Potential mechanisms for astrocyte-TIMP-1 downregulation in chronic inflammatory diseases.
16496359 2006 Novel role of TGF-beta in differential astrocyte-TIMP-1 regulation: implications for HIV-1-dementia and neuroinflammation.
16474379 2006 Association of E-cadherin, matrix metalloproteinases, and tissue inhibitors of metalloproteinases with the progression and metastasis of hepatocellular carcinoma.
16410344 2006 Proteasome blockade exerts an antifibrotic activity by coordinately down-regulating type I collagen and tissue inhibitor of metalloproteinase-1 and up-regulating metalloproteinase-1 production in human dermal fibroblasts.
16407831 2006 TIMP-1 regulation of cell cycle in human breast epithelial cells via stabilization of p27(KIP1) protein.
16372907 2005 MMP-9, TIMP-1 and inflammatory cells in sputum from COPD patients during exacerbation.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16289162 2006 The identification of myocilin-associated proteins in the human trabecular meshwork.
16288711 2005 Cell expression of MMP-1 and TIMP-1 in co-cultures of human gingival fibroblasts and monocytes: the involvement of ICAM-1.
16280123 2006 Elevated serum levels of proinflammatory cytokines and biomarkers of matrix remodeling in never-treated patients with familial hypercholesterolemia.
16269968 2005 Serum tissue inhibitors of metalloproteinases 1 (TIMP-1) and carotid atherosclerosis and aortic arterial stiffness.
16263699 2006 Elucidation of N-glycosylation sites on human platelet proteins: a glycoproteomic approach.
16248458 2005 [The protein expression difference of transforming growth factor beta1, matrix metalloproteinases 1,7,9 and tissue inhibitors of matrix metalloproteinases-1 between chronic rhinosinusitis, nasal polyps and normal mucosa tissues].
16219294 2005 High level production of secreted proteins: example of the human tissue inhibitor of metalloproteinases 1.
16191301 2005 [Clinical value of serum matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 for the prediction and early diagnosis of coronary artery lesion in patients with Kawasaki disease].
16188099 2005 [AP-1 Decoy modulating MMP-2/TIMP-1 imbalance induced by bleomycin-A5 in pulmonary fibroblasts].
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
16107690 2005 Phosphatidylinositol 3-kinase/Akt induced by erythropoietin renders the erythroid differentiation factor GATA-1 competent for TIMP-1 gene transactivation.
16103240 2005 Increased cardiac expression of tissue inhibitor of metalloproteinase-1 and tissue inhibitor of metalloproteinase-2 is related to cardiac fibrosis and dysfunction in the chronic pressure-overloaded human heart.
16100012 2005 Gene expression changes during the development of acute lung injury: role of transforming growth factor beta.
16061701 2005 A novel tissue inhibitor of metalloproteinase-1 (TIMP-1) polymorphism associated with asthma in Australian women.
16042227 2005 Serum MMP-9/TIMP-1 and MMP-2/TIMP-2 ratios in multiple sclerosis: relationships with different magnetic resonance imaging measures of disease activity during IFN-beta-1a treatment.
16019435 2005 Inhibitory activity on matrix metalloproteinases and cell-proliferating activity of tissue inhibitor of metalloproteinases-1 (TIMP-1)-contrastive difference between human and bovine TIMP-1s on mouse cell proliferation.
16005367 2005 Alterations in peripheral blood levels of TIMP-1, MMP-2, and MMP-9 in patients with type-2 diabetes.
15944607 2005 Genetic analysis of polymorphisms in biologically relevant candidate genes in patients with abdominal aortic aneurysms.
15896974 2005 Circulating beta-chemokines and matrix metalloproteinase-9/tissue inhibitor of metalloproteinase-1 system in hemodialyzed patients--role of oxidative stress.
15890357 2005 The gp130 ligand oncostatin M regulates tissue inhibitor of metalloproteinases-1 through ERK1/2 and p38 in human adult cardiac myocytes and in human adult cardiac fibroblasts: a possible role for the gp130/gp130 ligand system in the modulation of extracellular matrix degradation in the human heart.
15888067 2005 Broncho-alveolar lavage matrix metalloproteases as a sensitive measure of bronchiolitis obliterans.
15867221 2005 Tissue inhibitor of matrix metalloproteinase-1 is prognostic in head and neck squamous cell carcinoma: comparison of the circulating and tissue immunoreactive protein.
15841325 2005 Transcriptional control of cell density dependent regulation of matrix metalloproteinase and TIMP expression in breast cancer cell lines.
15818737 2005 Effects of fibril- or fixed-collagen on matrix metalloproteinase-1 and tissue inhibitor of matrix metalloproteinase-1 production in the human hepatocyte cell line HLE.
15797648 2005 Circulating matrix metalloproteinase-9 and tissue inhibitors of metalloproteinases-1 and -2 levels in gestational hypertension.
15754388 2005 Enhanced migration of tissue inhibitor of metalloproteinase overexpressing hepatoma cells is attributed to gelatinases: relevance to intracellular signaling pathways.
15754326 2005 Tissue inhibitor of metalloproteinase 1 is an independent predictor of prognosis in patients with nonsmall cell lung carcinoma who undergo resection with curative intent.
15616792 2005 Increased mRNA expression of tissue inhibitors of metalloproteinase-1 and -2 in Duchenne muscular dystrophy.
15557756 Matrix metalloproteinases 2 and 9 and their tissue inhibitors in low malignant potential ovarian tumors.
15530852 2004 TIMP-1 inhibits microvascular endothelial cell migration by MMP-dependent and MMP-independent mechanisms.
15516987 2004 Tissue inhibitor of matrix metalloproteinase-1 overexpression in M1 myeloblasts impairs IL-6-induced differentiation.
15515157 2004 TIMP1 and SERPIN-A overexpression and TFF3 and CRABP1 underexpression as biomarkers for papillary thyroid carcinoma.
15494493 2004 Prostaglandin E2-dependent enhancement of tissue inhibitors of metalloproteinases-1 production limits dendritic cell migration through extracellular matrix.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485866 2004 Sphingosine kinase 1 (SPHK1) is induced by transforming growth factor-beta and mediates TIMP-1 up-regulation.
15479729 2005 Tissue inhibitor of metalloproteinase 1 (TIMP-1) promotes plasmablastic differentiation of a Burkitt lymphoma cell line: implications in the pathogenesis of plasmacytic/plasmablastic tumors.
15465038 2004 TIMP-1 stimulates proliferation of human aortic smooth muscle cells and Ras effector pathways.
15363818 2004 Tissue inhibitor of metalloproteinase-1 and matrix metalloproteinase-9 levels in patients with hypertension Relationship to tissue Doppler indices of diastolic relaxation.
15363817 2004 Matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 in hypertension and their relationship to cardiovascular risk and treatment: a substudy of the Anglo-Scandinavian Cardiac Outcomes Trial (ASCOT).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15313474 2004 Association of a high activity of matrix metalloproteinase-9 to low levels of tissue inhibitors of metalloproteinase-1 and -3 in human hepatitis B-viral hepatoma cells.
15287862 2004 Increased levels of tissue inhibitor of metalloproteinase-1 in human hepatocellular carcinoma.
15277439 2004 Matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 and -2 in type 2 diabetes: effect of 1 year's cardiovascular risk reduction therapy.
15248826 2004 Intrafollicular expression of matrix metalloproteinases and their inhibitors in normally ovulating women compared with patients undergoing in vitro fertilization treatment.
15161657 2004 Signal transducer and activator of transcription-3 activation contributes to high tissue inhibitor of metalloproteinase-1 expression in anaplastic lymphoma kinase-positive anaplastic large cell lymphoma.
15073104 2004 Tumor tissue levels of tissue inhibitor of metalloproteinase-1 as a prognostic marker in primary breast cancer.
15051730 2004 Regulation of tissue inhibitor of metalloproteinase 1 gene transcription by RUNX1 and RUNX2.
15028476 2004 Expression of metalloproteinase-2, metalloproteinase-9, and tissue inhibitor of metalloproteinase-1 in transitional cell carcinoma of upper urinary tract: correlation with tumor stage and survival.
14983226 2004 Plasma MMP-2 and MMP-9 and their inhibitors TIMP-1 and TIMP-2 during human orthotopic liver transplantation. The effect of aprotinin and the relation to ischemia/reperfusion injury.
14973177 2004 MMP-2 and MMP-9 and their tissue inhibitors in the plasma of preterm and term neonates.
14962256 2004 Clinicopathological correlations of TIMP-1 and TIMP-2 in Hodgkin's lymphoma.
14871825 2004 TIMP-1 alters susceptibility to carcinogenesis.
14734567 2004 Threonine 98, the pivotal residue of tissue inhibitor of metalloproteinases (TIMP)-1 in metalloproteinase recognition.
14710472 2003 Different levels of TIMPs and MMPs in human lateral and medial rectus muscle tissue excised from strabismic patients.
14688084 2004 Tissue inhibitor of metalloproteinase 1 activates normal human granulocytes, protects them from apoptosis, and blocks their transmigration during inflammation.
14669348 2003 Plasma matrix metalloproteinase-1 and tissue inhibitor of metalloproteinase-1 as biomarkers of ulcerative colitis activity.
14661256 2004 Matrix metalloproteinases MMP-2, -9 and tissue inhibitors TIMP-1, -2 expression and secretion by primary human osteoblast cells in response to titanium, zirconia, and alumina ceramics.
14652000 2003 TIMP-1 inhibits apoptosis in breast carcinoma cells via a pathway involving pertussis toxin-sensitive G protein and c-Src.
14648584 2003 Tissue inhibitor of metalloproteinase (TIMP)-1: the TIMPed balance of matrix metalloproteinases in the central nervous system.
14630798 2004 Characterization of the proteins released from activated platelets leads to localization of novel platelet proteins in human atherosclerotic lesions.
14622947 2003 Down-regulation of tissue inhibitor of matrix metalloprotease-1 (TIMP-1) in aged human skin contributes to matrix degradation and impaired cell growth and survival.
14605322 2003 Tissue inhibitor of metalloproteinases-1, -2, and -3 polymorphisms in a white population with intracranial aneurysms.
14517716 2004 The contribution of familial resemblance to variation in circulatory levels of tissue inhibitors of metalloproteinases and transforming growth factor-beta1.
12970724 2003 Expression of matrix metalloproteinases (MMP-2 and -9) and their inhibitors (TIMP-1 and -2) in prostate cancer tissue.
12951656 2003 Regulation of tissue inhibitor of metalloproteinase-1 by astrocytes: links to HIV-1 dementia.
12921631 2003 [The role of matrix metalloproteinases-9 and tissue inhibitor of metalloproteinaes-1 in chronic obstructive pulmonary disease].
12904305 2003 Tissue inhibitor of metalloproteinase-1 protects human breast epithelial cells against intrinsic apoptotic cell death via the focal adhesion kinase/phosphatidylinositol 3-kinase and MAPK signaling pathway.
12873541 2003 Increased expression of extracellular matrix regulators TIMP1 and MMP1 in deteriorating heart failure.
12869573 2003 Unveiling the surface epitopes that render tissue inhibitor of metalloproteinase-1 inactive against membrane type 1-matrix metalloproteinase.
12861139 2003 Differences in estrogen modulation of tissue inhibitor of matrix metalloproteinase-1 and matrix metalloproteinase-1 expression in cultured fibroblasts from continent and incontinent women.
12846741 2003 STAT proteins mediate angiotensin II-induced production of TIMP-1 in human proximal tubular epithelial cells.
12834347 2003 Global orientation of bound MMP-3 and N-TIMP-1 in solution via residual dipolar couplings.
12791318 2003 Matrix metalloproteinase-9 and its natural inhibitor TIMP-1 expressed or secreted by peripheral blood mononuclear cells from patients with systemic lupus erythematosus.
12771930 2003 A novel IL-10 signalling mechanism regulates TIMP-1 expression in human prostate tumour cells.
12717827 2003 Imbalance between expression of matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 in invasiveness and metastasis of human gastric carcinoma.
12714508 2003 The disintegrin-like metalloproteinase ADAM10 is involved in constitutive cleavage of CX3CL1 (fractalkine) and regulates CX3CL1-mediated cell-cell adhesion.
12704667 2003 Tissue inhibitor of metalloproteinases-1 (TIMP-1) inhibits tumor growth and angiogenesis in the TIMP-1 transgenic mouse model.
12651627 2003 Expression and regulation of tissue inhibitor of metalloproteinase-1 and matrix metalloproteinases by intestinal myofibroblasts in inflammatory bowel disease.
12634064 2003 Increased backbone mobility in beta-barrel enhances entropy gain driving binding of N-TIMP-1 to MMP-3.
12626459 2003 Elevated levels of matrix metalloproteinase 9 and tissue inhibitor of metalloproteinase 1 during the acute phase of Kawasaki disease.
12620441 2003 Decreased expression of tissue inhibitor of matrix metalloproteinases in follicular fluid from women with polycystic ovaries compared with normally ovulating patients undergoing in vitro fertilization.
12614934 2003 Tissue inhibitors of matrix metalloproteinases are elevated in cerebrospinal fluid of neurodegenerative diseases.
12612199 2003 Matrix metalloproteinase-9 and tissue inhibitor of metalloproteinases-1 in acute pyelonephritis and renal scarring.
12538453 2003 Hepatocyte growth factor receptor, matrix metalloproteinase-11, tissue inhibitor of metalloproteinase-1, and fibronectin are up-regulated in papillary thyroid carcinoma: a cDNA and tissue microarray study.
12496489 IL-10/IL-10 receptor signaling regulates TIMP-1 expression in primary human prostate tumor lines.
12479097 2002 [Expression of matrix metalloproteinase-2, 9 and their inhibitor-TIMP 1,2 in human squamous cell carcinoma of uterine cervix].
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12475252 2002 E. coli expression of TIMP-4 and comparative kinetic studies with TIMP-1 and TIMP-2: insights into the interactions of TIMPs and matrix metalloproteinase 2 (gelatinase A).
12452001 2002 [Relationship of expression unbalance of matrix metalloproteinase and tissue inhibitor of metalloproteinase to invasiveness and metastasis in gastric carcinomas].
12406369 2002 Tissue inhibitors of metalloproteinases 1 and 2 in human seminal plasma and their association with spermatozoa.
12376362 2002 Gelatinase activities in the airways of premature infants and development of bronchopulmonary dysplasia.
12218659 2002 Genetic polymorphisms and cerebrospinal fluid levels of tissue inhibitor of metalloproteinases 1 in sporadic Alzheimer's disease.
12150976 2002 Staurosporine enhances the expression of tissue inhibitor of metalloproteinase-1 in human prostate cancer cells.
12147251 2002 Both tissue inhibitors of metalloproteinases-1 (TIMP-1) and TIMP-2 activate Ras but through different pathways.
12082592 2002 Multi-locus interactions predict risk for post-PTCA restenosis: an approach to the genetic analysis of common complex disease.
12063180 2002 Regulation of TIMP-1 phenotypic expression in Epstein--Barr virus-immortalized B lymphocytes.
12034345 2002 Expression of matrix metalloproteinases in ovarian endometriomas: immunohistochemical study and enzyme immunoassay.
12032189 2002 Elevation of serum and urine levels of TIMP-1 and tenascin in patients with renal disease.
11940298 2002 [Expression of matrix metalloproteinase-9 and tissue inhibitor of metalloproteinase-1 in IgA nephropathy].
11876751 2002 Increased levels of serum tissue inhibitor of metalloproteinase-1 but not metalloproteinase-3 in atopic dermatitis.
11762702 2001 Effects of 17beta-estradiol on the expression of matrix metalloproteinase-1, -2 and tissue inhibitor of metalloproteinase-1 in human osteoblast-like cell cultures.
11705862 2001 Prognostic significance of matrix metalloproteinase-1 and tissue inhibitor of metalloproteinase-1 in voided urine samples from patients with transitional cell carcinoma of the bladder.
11606052 2001 Differential growth regulation in human melanoma cell lines by TIMP-1 and TIMP-2.
11598182 2001 Activation of matrix-metalloproteinase-2 and membrane-type-1-matrix-metalloproteinase in endothelial cells and induction of vascular permeability in vivo by human immunodeficiency virus-1 Tat protein and basic fibroblast growth factor.
11279011 2001 The low density lipoprotein receptor-related protein modulates levels of matrix metalloproteinase 9 (MMP-9) by mediating its cellular catabolism.
10623524 2000 NMR structure of tissue inhibitor of metalloproteinases-1 implicates localized induced fit in recognition of matrix metalloproteinases.
10441576 1999 Polymorphic X-chromosome inactivation of the human TIMP1 gene.
10233411 1999 Expression of matrix metalloproteinases (MMP-2 and -9) and tissue inhibitors of metalloproteinases (TIMP-1 and -2) in acute myelogenous leukaemia blasts: comparison with normal bone marrow cells.
10071915 1999 Tissue inhibitor of matrix metalloproteinase-1 (TIMP-1) distribution in normal and pathological human bone.
9778693 1998 Identification of positive and negative regulator elements for the tissue inhibitor of metalloproteinase 1 gene.
9573338 1998 Cloning of three Caenorhabditis elegans genes potentially encoding novel matrix metalloproteinases.
9288970 1997 Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
9286280 1997 Genomic organization of the human TIMP-1 gene. Investigation of a causative role in the pathogenesis of X-linked retinitis pigmentosa 2.
9065415 1997 The role of the C-terminal domain of human collagenase-3 (MMP-13) in the activation of procollagenase-3, substrate specificity, and tissue inhibitor of metalloproteinase interaction.
9063449 1997 The catalytic domain of activated collagenase I (MMP-1) is absolutely required for interaction with its specific inhibitor, tissue inhibitor of metalloproteinases-1 (TIMP-1).
8757599 1996 HIV-1-Tat protein promotes chemotaxis and invasive behavior by monocytes.
8576151 1996 Biochemical characterization of human collagenase-3.
8541540 1995 Metalloproteinase inhibition and erythroid potentiation are independent activities of tissue inhibitor of metalloproteinases-1.
7507419 1993 Characterization of a human corneal metalloproteinase inhibitor (TIMP-1).
3903517 1985 Sequence of human tissue inhibitor of metalloproteinases and its identity to erythroid-potentiating activity.
3839290 1985 Molecular characterization and expression of the gene encoding human erythroid-potentiating activity.
3688834 1987 Chromosomal assignment of the gene encoding the human tissue inhibitor of metalloproteinases to Xp11.1-p11.4.
3460333 1986 Localization of the gene encoding human erythroid-potentiating activity to chromosome region Xp11.1----Xp11.4.
3010309 1986 Primary structure and cDNA cloning of human fibroblast collagenase inhibitor.
2921031 1989 Regional localization of the TIMP gene on the human X chromosome. Extension of a conserved synteny and linkage group on proximal Xp.
2251898 1990 [The subject of epidemiology].
2171551 1990 Characterization of three abundant mRNAs from human ovarian granulosa cells.
2163605 1990 Disulphide bond assignment in human tissue inhibitor of metalloproteinases (TIMP).
1730286 1992 Isolation and characterization of tissue inhibitors of metalloproteinases (TIMP-1 and TIMP-2) from human rheumatoid synovial fluid.
1653055 1991 The cytokine-protease connection: identification of a 96-kD THP-1 gelatinase and regulation by interleukin-1 and cytokine inducers.
1420137 1992 Site-directed mutations that alter the inhibitory activity of the tissue inhibitor of metalloproteinases-1: importance of the N-terminal region between cysteine 3 and cysteine 13.