Property Summary

NCBI Gene PubMed Count 12
PubMed Score 21.73
PubTator Score 11.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
Multiple myeloma 1.044 9.1e-03
osteosarcoma -1.443 3.8e-05
lung cancer 2.300 1.5e-02
diabetes mellitus -1.300 1.5e-03
ovarian cancer -1.100 7.2e-04

Gene RIF (3)

PMID Text
20877624 Observational study of gene-disease association. (HuGE Navigator)
16387659 The crystal structure of TIM9.10 described here reveals a previously undescribed alpha-propeller topology in which helical "blades" radiate from a narrow central pore lined with polar residues.
14726512 in contrast to yeast, only a small fraction of Tim9-Tim10a-Tim10b complex is in a stable association with Tim22

AA Sequence

MAAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEY      1 - 70
HIQQNEALAAKAGLLGQPR                                                        71 - 89
//

Text Mined References (16)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23172368 2012 Mitochondria "fuel" breast cancer metabolism: fifteen markers of mitochondrial biogenesis label epithelial cancer cells, but are excluded from adjacent stromal cells.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16387659 2006 Crystal structure of the mitochondrial chaperone TIM9.10 reveals a six-bladed alpha-propeller.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14726512 2004 Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12138093 2002 Assembly of Tim9 and Tim10 into a functional chaperone.
11489896 2001 Role of the deafness dystonia peptide 1 (DDP1) in import of human Tim23 into the inner membrane of mitochondria.
10611480 1999 The mitochondrial TIM22 preprotein translocase is highly conserved throughout the eukaryotic kingdom.
10552927 1999 The human family of Deafness/Dystonia peptide (DDP) related mitochondrial import proteins.