Property Summary

NCBI Gene PubMed Count 15
PubMed Score 26.38
PubTator Score 15.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma 2.300 1.4e-06
non-small cell lung cancer 1.023 5.8e-16
ovarian cancer 1.400 1.4e-04

Gene RIF (6)

PMID Text
23098911 the interaction of divalent metal ions with the intermembrane space domain of Tim50 (Tim50(IMS)) and the interaction of presequence peptides with Tim50(IMS) in presence of Ca(2+) ion was investigated.
21930695 Tim50 regulates 3betaHSD2 expression and activity, representing a new role for translocases in steroidogenesis.
21742040 The far-UV CD spectra of Tim50(IMS) in native and denatured states revealed that the protein has a significantly folded secondary structure consisted of alpha-helixes and beta-sheets.
21621504 TIM50, was upregulated in a non-small cell lung carcinoma cell line (H1299) that expressed the p53 mutants R175H and R273H compared to cells lacking p53.
16008839 Tim50a, a nuclear isoform of the mitochondrial Tim50, interacts with coilin, snRNPs, and SMN
15044455 Tim50 is important for both mitochondrial function and early neuronal development

AA Sequence

MAASAAVFSRLRSGLRLGSRGLCTRLATPPRRAPDQAAEIGSRGSTKAQGPQQQPGSEGPSYAKKVALWL      1 - 70
AGLLGAGGTVSVVYIFGNNPVDENGAKIPDEFDNDPILVQQLRRTYKYFKDYRQMIIEPTSPCLLPDPLQ     71 - 140
EPYYQPPYTLVLELTGVLLHPEWSLATGWRFKKRPGIETLFQQLAPLYEIVIFTSETGMTAFPLIDSVDP    141 - 210
HGFISYRLFRDATRYMDGHHVKDISCLNRDPARVVVVDCKKEAFRLQPYNGVALRPWDGNSDDRVLLDLS    211 - 280
AFLKTIALNGVEDVRTVLEHYALEDDPLAAFKQRQSRLEQEEQQRLAELSKSNKQNLFLGSLTSRLWPRS    281 - 350
KQP                                                                       351 - 353
//

Text Mined References (20)

PMID Year Title
26289846 2016 Loss of TIM50 suppresses proliferation and induces apoptosis in breast cancer.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
23263864 2013 Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23098911 2012 Interaction of divalent metal ions with human translocase of inner membrane of mitochondria Tim50.
22335443 2012 Interaction of presequence with human translocase of the inner membrane of mitochondria Tim50.
21930695 2011 Inner mitochondrial translocase Tim50 interacts with 3?-hydroxysteroid dehydrogenase type 2 to regulate adrenal and gonadal steroidogenesis.
21742040 2011 Expression and structural characterization of human translocase of inner membrane of mitochondria Tim50.
21621504 2011 Upregulation of the mitochondrial transport protein, Tim50, by mutant p53 contributes to cell growth and chemoresistance.
21269460 2011 Initial characterization of the human central proteome.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16008839 2005 Tim50a, a nuclear isoform of the mitochondrial Tim50, interacts with proteins involved in snRNP biogenesis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
15044455 2004 Tim50, a component of the mitochondrial translocator, regulates mitochondrial integrity and cell death.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12620389 2003 Novel raf kinase protein-protein interactions found by an exhaustive yeast two-hybrid analysis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437925 2002 Tim50 is a subunit of the TIM23 complex that links protein translocation across the outer and inner mitochondrial membranes.