Property Summary

NCBI Gene PubMed Count 18
PubMed Score 36.46
PubTator Score 12.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7766 2.0e-05
psoriasis 6514 1.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11192 0.0 0.5

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma 1.475 2.0e-05
psoriasis 1.600 1.3e-04

Gene RIF (3)

AA Sequence

MAAAALRSGWCRCPRRCLGSGIQFLSSHNLPHGSTYQMRRPGGELPLSKSYSSGNRKGFLSGLLDNVKQE      1 - 70
LAKNKEMKESIKKFRDEARRLEESDVLQEARRKYKTIESETVRTSEVLRKKLGELTGTVKESLHEVSKSD     71 - 140
LGRKIKEGVEEAAKTAKQSAESVSKGGEKLGRTAAFRALSQGVESVKKEIDDSVLGQTGPYRRPQRLRKR    141 - 210
TEFAGDKFKEEKVFEPNEEALGVVLHKDSKWYQQWKDFKENNVVFNRFFEMKMKYDESDNAFIRASRALT    211 - 280
DKVTDLLGGLFSKTEMSEVLTEILRVDPAFDKDRFLKQCENDIIPNVLEAMISGELDILKDWCYEATYSQ    281 - 350
LAHPIQQAKALGLQFHSRILDIDNVDLAMGKMMEQGPVLIITFQAQLVMVVRNPKGEVVEGDPDKVLRML    351 - 420
YVWALCRDQDELNPYAAWRLLDISASSTEQIL                                          421 - 452
//

Text Mined References (23)

PMID Year Title