Property Summary

NCBI Gene PubMed Count 10
PubMed Score 8.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
Alzheimer's disease -1.200 2.9e-02
astrocytic glioma 1.300 1.4e-02
ependymoma 1.600 1.8e-02
interstitial lung disease 1.200 5.8e-03
intraductal papillary-mucinous adenoma (... 1.600 8.7e-05
intraductal papillary-mucinous carcinoma... 1.600 1.4e-04
oligodendroglioma 1.700 6.6e-03
osteosarcoma 2.867 5.8e-07
ovarian cancer 1.400 1.7e-04
Pick disease -1.400 9.0e-06
progressive supranuclear palsy -1.200 1.3e-02

AA Sequence

MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTR      1 - 70
GRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSA     71 - 140
FGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTETGFHHGAQANFQSEIIFRFLTRFFYAKKKASYSQISQK    141 - 210
NLDFTILLRLKTLRSVESKCYVIFVVDELLKNRIPQRIKCLMHNKPT                           211 - 257
//

Text Mined References (10)

PMID Year Title