Property Summary

NCBI Gene PubMed Count 23
PubMed Score 8.84
PubTator Score 54.99

Knowledge Summary

Patent

No data available

Gene RIF (6)

PMID Text
25519239 Modulating the sorting of nuclear-encoded proteins into mitochondria, mediated by the TIM23 complex, proves therapeutic in both yeast and patient-derived cells exhibiting ATP synthase deficiency.
24636990 Three distinct Tim23 complexes, namely, B1, B2, and A, are involved in the maintenance of normal mitochondrial function.
23811401 GST pull-down experiments and tryptophan fluorescence indicated that there is no interaction between Tim23IMS and Tim50IMS
23263864 MCJ functions as J co-chaperone of the human TIM23 pre-protein translocase.
23260140 Study establishes an unexpected molecular link between the TIM23 transport machinery and assembly of respiratory-chain complexes that regulate mitochondrial protein synthesis in response to their assembly state.
22306744 The non-bound hydrophilic domain of the human Tim23 is in a molten globule configuration with marginal stability, existing as a dimer.

AA Sequence

MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTR      1 - 70
GRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSA     71 - 140
FGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL     141 - 209
//

Text Mined References (24)

PMID Year Title
25997101 2015 QIL1 is a novel mitochondrial protein required for MICOS complex stability and cristae morphology.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25519239 2014 Mitochondrial protein sorting as a therapeutic target for ATP synthase disorders.
24636990 2014 Unraveling the intricate organization of mammalian mitochondrial presequence translocases: existence of multiple translocases for maintenance of mitochondrial function.
23811401 2013 Interaction of presequence peptides with human translocase of inner membrane of mitochondria Tim23.
23263864 2013 Methylation-controlled J-protein MCJ acts in the import of proteins into human mitochondria.
23260140 2012 MITRAC links mitochondrial protein translocation to respiratory-chain assembly and translational regulation.
22306744 2012 The structural characteristics of human preprotein translocase of the inner mitochondrial membrane Tim23: implications for its physiological activities.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20053669 2010 Role of Magmas in protein transport and human mitochondria biogenesis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16368877 2006 Genomic annotation of 15,809 ESTs identified from pooled early gestation human eyes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
15044455 2004 Tim50, a component of the mitochondrial translocator, regulates mitochondrial integrity and cell death.
14726512 2004 Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12437925 2002 Tim50 is a subunit of the TIM23 complex that links protein translocation across the outer and inner mitochondrial membranes.
10393182 1999 The TIM17.23 preprotein translocase of mitochondria: composition and function in protein transport into the matrix.
10339406 1999 Genetic and structural characterization of the human mitochondrial inner membrane translocase.
8570611 1996 Analysis of differential gene expression by display of 3' end restriction fragments of cDNAs.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.