Property Summary

NCBI Gene PubMed Count 11
PubMed Score 5.81
PubTator Score 18.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 8.0e-07
psoriasis 6694 9.9e-05
osteosarcoma 7950 2.7e-04
pulmonary arterial hypertension 75 3.5e-02
Disease Target Count Z-score Confidence
Sengers syndrome 18 5.576 2.8

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.154 2.7e-04
ovarian cancer -1.100 8.0e-07
psoriasis -1.600 9.9e-05
pulmonary arterial hypertension -1.100 3.5e-02

Gene RIF (4)

AA Sequence

MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCA      1 - 70
FKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTE     71 - 140
CLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR                    141 - 194
//

Text Mined References (14)

PMID Year Title