Property Summary

NCBI Gene PubMed Count 6
PubMed Score 10.75
PubTator Score 5.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 3.3e-03
Breast cancer 3578 3.2e-02
acute myeloid leukemia 783 4.7e-02

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia -2.100 4.7e-02
Breast cancer 2.300 3.2e-02
ovarian cancer -1.100 3.3e-03

Gene RIF (2)

AA Sequence

MICTFLRAVQYTEKLHRSSAKRLLLPYIVLNKACLKTEPSLRCGLQYQKKTLRPRCILGVTQKTIWTQGP      1 - 70
SPRKAKEDGSKQVSVHRSQRGGTAVPTSQKVKEAGRDFTYLIVVLFGISITGGLFYTIFKELFSSSSPSK     71 - 140
IYGRALEKCRSHPEVIGVFGESVKGYGEVTRRGRRQHVRFTEYVKDGLKHTCVKFYIEGSEPGKQGTVYA    141 - 210
QVKENPGSGEYDFRYIFVEIESYPRRTIIIEDNRSQDD                                    211 - 248
//

Text Mined References (8)

PMID Year Title