Property Summary

NCBI Gene PubMed Count 18
PubMed Score 66.60
PubTator Score 20.32

Knowledge Summary

Patent

No data available

Expression

 GO Function (1)

Gene RIF (1)

PMID Text
22190034 HIV-1 gp41 is identified to have a physical interaction with translocase of inner mitochondrial membrane 13 homolog (TIMM13) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses

AA Sequence

MEGGFGSDFGGSGSGKLDPGLIMEQVKVQIAVANAQELLQRMTDKCFRKCIGKPGGSLDNSEQKCIAMCM      1 - 70
DRYMDAWNTVSRAYNSRLQRERANM                                                  71 - 95
//

Text Mined References (23)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17329230 2007 Conserved motifs reveal details of ancestry and structure in the small TIM chaperones of the mitochondrial intermembrane space.
16387659 2006 Crystal structure of the mitochondrial chaperone TIM9.10 reveals a six-bladed alpha-propeller.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254020 2004 The calcium-binding aspartate/glutamate carriers, citrin and aralar1, are new substrates for the DDP1/TIMM8a-TIMM13 complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221072 2002 The role of the Tim8p-Tim13p complex in a conserved import pathway for mitochondrial polytopic inner membrane proteins.
12191765 2002 Protein import into and across the mitochondrial inner membrane: role of the TIM23 and TIM22 translocons.
12185844 2002 How mitochondria import hydrophilic and hydrophobic proteins.
12154367 2002 The protein import motor of mitochondria.
11875042 2002 Human deafness dystonia syndrome is caused by a defect in assembly of the DDP1/TIMM8a-TIMM13 complex.
11798021 Protein import into mitochondria.
11489896 2001 Role of the deafness dystonia peptide 1 (DDP1) in import of human Tim23 into the inner membrane of mitochondria.
11450972 2001 The mitochondrial import machinery for preproteins.
11101512 2000 The role of the TIM8-13 complex in the import of Tim23 into mitochondria.
10611480 1999 The mitochondrial TIM22 preprotein translocase is highly conserved throughout the eukaryotic kingdom.
10552927 1999 The human family of Deafness/Dystonia peptide (DDP) related mitochondrial import proteins.