Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.77
PubTator Score 0.34

Knowledge Summary


No data available


  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 5.5e-09
osteosarcoma 7933 3.5e-06


  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.083 3.5e-06
ovarian cancer -2.000 5.5e-09

 GO Function (1)

Gene RIF (1)

20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MPALVQRRIADYEAASAVPGVAAEQPGVSPSGS                                          71 - 103

Text Mined References (13)

PMID Year Title
27554484 2016 Tim29 is a novel subunit of the human TIM22 translocase and is involved in complex assembly and stability.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14726512 2004 Organization and function of the small Tim complexes acting along the import pathway of metabolite carriers into mammalian mitochondria.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11489896 2001 Role of the deafness dystonia peptide 1 (DDP1) in import of human Tim23 into the inner membrane of mitochondria.
10611480 1999 The mitochondrial TIM22 preprotein translocase is highly conserved throughout the eukaryotic kingdom.
10552927 1999 The human family of Deafness/Dystonia peptide (DDP) related mitochondrial import proteins.
9731230 1998 Cloning of a novel cDNA expressed during the early stages of fracture healing.