Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.77
PubTator Score 0.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 5.5e-09
osteosarcoma 7950 3.5e-06

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -2.083 3.5e-06
ovarian cancer -2.000 5.5e-09

 GO Function (1)

Gene RIF (1)

AA Sequence

MERQQQQQQQLRNLRDFLLVYNRMTELCFQRCVPSLHHRALDAEEEACLHSCAGKLIHSNHRLMAAYVQL      1 - 70
MPALVQRRIADYEAASAVPGVAAEQPGVSPSGS                                          71 - 103
//

Text Mined References (14)

PMID Year Title