Property Summary

NCBI Gene PubMed Count 22
PubMed Score 38.99
PubTator Score 11.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.265 1.4e-03
interstitial cystitis 2.000 1.6e-03
primary Sjogren syndrome 1.400 1.6e-03
invasive ductal carcinoma 1.100 2.5e-02
psoriasis 2.200 2.3e-92

Gene RIF (19)

PMID Text
26842126 implying that TIGIT exerts immunosuppressive effects by competing with DNAM-1 for the same ligand, CD155
26741490 These findings identify TIGIT as a novel marker of dysfunctional HIV-specific T cells
26735971 This study shows that HBZ-induced TIGIT plays a pivotal role in attenuating host immune responses and shaping a microenvironment favorable to human T-cell leukemia virus type 1.
26250578 TIGIT-positive circulating follicular helper T cells display robust B-cell help functions: potential role in sickle cell alloimmunization.
26171588 a novel mechanism that links TIGIT expression with NK-cell functional heterogeneity, and this mechanism might partially explain why individuals have different susceptibilities to infection, autoimmune disease, and cancer.
25994968 Human regulatory T cells expressing the receptors TIGIT and CD226 display widely divergent phenotypes in regard to expansion and activation.
25866972 TIGIT and PD-1 blockade additively increased proliferation, cytokine production, and degranulation of tumor-antigen-specific CD8 T cells and CD8 TILs. TIGIT and PD-1 regulate the expansion and function of these T cells in melanoma.
25762785 the TIGIT/FCRL3 combination allows reliable identification of Helios(+) Treg cells even in highly activated conditions in vitro as well as in PBMCs of autoimmune patients.
25680274 The results identify a bacterium-dependent, tumor-immune evasion mechanism in which tumors exploit the Fap2 protein of F. nucleatum to inhibit immune cell activity via TIGIT.
25465800 Findings suggest that TIGIT is a key checkpoint inhibitor of chronic antiviral and antitumor responses through impairing CD226 function when disrupting its homodimerization.
24817116 TIGIT/PVR ligation signaling mediates suppression of IFN-gamma production via the NF-kappaB pathway.
23154388 TIGIT is phosphorylated at its cytoplasmic tail after its ligation with PVR.
22706088 The Tim-3 pathway appears to control regulatory (Treg) and effector T cell balance via altering cell proliferation and apoptosis during hepatitis C virus infection.
22427644 TIGIT can inhibit T cell functions by competing with CD226 and can also directly inhibit T cells in a T cell-intrinsic manner.
22421438 data suggest a cis-trans receptor clustering mechanism for cell adhesion and signaling by the TIGIT/PVR complex and provide structural insights into how the PVR family of immunoregulators function
21416464 that soluble Vstm3 attenuates T-cell responses in vitro and in vivo
19815499 TIGIT counter inhibits the NK-mediated killing of tumor cells and protects normal cells from NK-mediated cytotoxicity thus providing an "alternative self" mechanism for MHC class I inhibition.
19197944 a novel immunoreceptor, Washington University Cell Adhesion Molecule, which is expressed on human follicular B helper T cells, was described.
19011627 TIGIT exerts immunosuppressive effects by binding to poliovirus receptor and modulating cytokine production by dendritic cells.

AA Sequence

MRWCLLLIWAQGLRQAPLASGMMTGTIETTGNISAEKGGSIILQCHLSSTTAQVTQVNWEQQDQLLAICN      1 - 70
ADLGWHISPSFKDRVAPGPGLGLTLQSLTVNDTGEYFCIYHTYPDGTYTGRIFLEVLESSVAEHGARFQI     71 - 140
PLLGAMAATLVVICTAVIVVVALTRKKKALRIHSVEGDLRRKSAGQEEWSPSAPSPPGSCVQAEAAPAGL    141 - 210
CGEQRGEDCAELHDYFNVLSYRSLGNCSFFTETG                                        211 - 244
//

Text Mined References (24)

PMID Year Title
26842126 2016 Immunoreceptor TIGIT inhibits the cytotoxicity of human cytokine-induced killer cells by interacting with CD155.
26741490 2016 TIGIT Marks Exhausted T Cells, Correlates with Disease Progression, and Serves as a Target for Immune Restoration in HIV and SIV Infection.
26735971 2016 HTLV-1 bZIP Factor Impairs Anti-viral Immunity by Inducing Co-inhibitory Molecule, T Cell Immunoglobulin and ITIM Domain (TIGIT).
26250578 2015 TIGIT-positive circulating follicular helper T cells display robust B-cell help functions: potential role in sickle cell alloimmunization.
26171588 2015 TIGIT expression levels on human NK cells correlate with functional heterogeneity among healthy individuals.
25994968 2015 Divergent Phenotypes of Human Regulatory T Cells Expressing the Receptors TIGIT and CD226.
25866972 2015 TIGIT and PD-1 impair tumor antigen-specific CD8? T cells in melanoma patients.
25762785 2015 Coexpression of TIGIT and FCRL3 identifies Helios+ human memory regulatory T cells.
25680274 2015 Binding of the Fap2 protein of Fusobacterium nucleatum to human inhibitory receptor TIGIT protects tumors from immune cell attack.
25465800 2014 The immunoreceptor TIGIT regulates antitumor and antiviral CD8(+) T cell effector function.
24817116 2014 T-cell immunoglobulin and ITIM domain (TIGIT) receptor/poliovirus receptor (PVR) ligand engagement suppresses interferon-? production of natural killer cells via ?-arrestin 2-mediated negative signaling.
23154388 2013 Recruitment of Grb2 and SHIP1 by the ITT-like motif of TIGIT suppresses granule polarization and cytotoxicity of NK cells.
22706088 2012 Tim-3 pathway controls regulatory and effector T cell balance during hepatitis C virus infection.
22427644 2012 The TIGIT/CD226 axis regulates human T cell function.
22421438 2012 Structure of TIGIT immunoreceptor bound to poliovirus receptor reveals a cell-cell adhesion and signaling mechanism that requires cis-trans receptor clustering.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21416464 2011 Vstm3 is a member of the CD28 family and an important modulator of T-cell function.
19815499 2009 The interaction of TIGIT with PVR and PVRL2 inhibits human NK cell cytotoxicity.
19197944 2009 A novel molecular interaction for the adhesion of follicular CD4 T cells to follicular DC.
19011627 2009 The surface protein TIGIT suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.