Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.22
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
adrenocortical carcinoma 1427 4.0e-06
osteosarcoma 7933 4.4e-03
ovarian cancer 8491 1.4e-02
spina bifida 1064 2.3e-02

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.116 4.4e-03
adrenocortical carcinoma 1.797 4.0e-06
spina bifida -1.634 2.3e-02
ovarian cancer 1.300 1.4e-02

Gene RIF (1)

PMID Text
15487591 TIGD7 is a Jerky and JRK/JH8 like gene

AA Sequence

MNKRGKYTTLNLEEKMKVLSRIEAGRSLKSVMDEFGISKSTFYDIKKNKKLILDFVLKQDMPLVGAEKRK      1 - 70
RTTGAKYGDVDDAVYMWYQQKRSAGVPVRGVELQAAAERFARCFGRTDFKASTGWLFRFRNRHAIGNRKG     71 - 140
CGEQVLSSVSENVEPFRQKLSMIIKEEKLCLAQLYSGDETDLFWKSMPENSQASRKDICLPGKKINKERL    141 - 210
SAFLCANADGTHKLKSIIIGKSKLPKSVKEDTSTLPVIYKPSKDVWFTRELFSEWFFQNFVPEVRHFQLN    211 - 280
VLRFHDEDVRALLLLDSCPAHPSSESLTSEDGRIKCMFFPHNTSTLIQPMNQGVILSCKRLYRWKQLEES    281 - 350
LVIFEESDDEQEKGDKGVSKIKIYNIKSAIFNWAKSWEEVKQITIANAWENLLYKKEPEYDFQGLEHGDY    351 - 420
REILEKCGELETKLDDDRVWLNGDEEKGCLLKTKGGITKEVVQKGGEAEKQTAEFKLSAVRESLDYLLDF    421 - 490
VDATPEFQRFHFTLKEMQQEIVKKQFQSKIHSRIGSFLKPRPHNIKDSFSGPSTSGSNH               491 - 549
//

Text Mined References (5)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15487591 2004 Isolation and characterization of a Jerky and JRK/JH8 like gene, tigger transposable element derived 7, TIGD7.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.