Property Summary

NCBI Gene PubMed Count 6
PubMed Score 4.00
PubTator Score 2.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q96MW7 Q6P4D2 Q6PIF9
Symbols EEYORE

Gene

  Ortholog (2)

AA Sequence

MASKCSSERKSRTSLTLNQKLEMIKLSEEGMSKAEIGRRLGLLRQTVSQVVNAKEKFLKEVKSATPMNTR      1 - 70
MIRKRNSLIADMEKVLVVWIEDQTSRNIPLSQSLIQNKALTLFNSMKAERGVEAAEEKFEASRGWFMRFK     71 - 140
ERSHFHNIKAQGEAASADVEAAASYPEALAKIIDEGGYTKQQIFNVDETAFYWKKMPSRTFIAREEKSVP    141 - 210
GFKASKDRLTLLLGANAAGDFKLKPMLIYHSENPRALKNYTKSTLPVLYKWNSKARMTAHLFTAWFTEYF    211 - 280
KPTVETYCSEKKIPFKILLLIDNAPSHPRALMEIYEEINVIFMPANTTSILQPMDQGVISTFKSYYLRNT    281 - 350
FHKALAAMDSDVSDGSGQSKLKTFWKGFTILDAIKNIRDSWEEVKLSTLTGVWKKLIPTLIDDYEGFKTS    351 - 420
VEEVSADVVEIAKELELEVEPEDVTELLQSHDKTLTDEELFLMDAQRKWFLEMESTPGEDAVNIVEMTTK    421 - 490
DLEYYINLVDKAAAGFERIDSNFERSSTVGKMLSNSIACYREIFHERKSQLMRKASPMSYFRKLPQPPQP    491 - 560
SAATTLTSQQPSTSRQDPPPAKRVRLTEGSD                                           561 - 591
//

Text Mined References (7)

PMID Year Title