Property Summary

NCBI Gene PubMed Count 40
PubMed Score 51.07
PubTator Score 49.64

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.400 3.2e-02
psoriasis 2.000 7.0e-05
cutaneous lupus erythematosus 1.700 2.2e-04
glioblastoma 2.200 8.9e-04
active Crohn's disease 1.556 3.4e-02
active ulcerative colitis 1.268 2.5e-02
interstitial cystitis 1.600 2.3e-03
group 4 medulloblastoma 2.300 8.3e-05
nasopharyngeal carcinoma 1.300 1.4e-03
ductal carcinoma in situ 1.300 2.9e-03
ovarian cancer 1.700 8.0e-04

Synonym

Accession Q9NQ88 B2R840
Symbols FR2BP
C12orf5

Gene

PANTHER Protein Class (2)

PDB

3DCY  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (26)

PMID Text
26700591 Geranylgeranoic acid induced upregulation of the TIGAR gene, which might inhibit the glycolysis in HuH-7 cells with p53 mutation.
26691054 TIGAR knockdown reduced tumor growth rate.
26675982 TIGAR expression may be used as a bio-marker for detection of colorectal cancer and can be used as a target for developing therapeutics for the treatment of colorectal cancer.
26191173 TIGAR over-expression could diminish the radiosensitivity of Hs 917.T cells, and the autophagy level induced by ionizing radiation (IR) was also decreased by TIGAR transfection.
25928429 The Cdk5-AMT signal pathway involved in regulation of DDR by TIGAR.
25660220 miR-144 targeted TIGAR, inhibited proliferation, enhanced apoptosis, and increased autophagy in A549 and H460 cells
25085248 Results revealed that TIGAR inhibits both apoptosis and autophagy.
24632713 Data show targeting MUC1-C is synergistic with bortezomib (BTZ) in suppressing p53-inducible regulator of glycolysis and apoptosis (TIGAR)-mediated regulation of reactive oxygen species levels for combining GO-203 with BTZ in BTZ resistance.
24423178 The kinetic properties and the structural similarity of the best substrates of TIGAR make it unlikely that TIGAR modulates cellular fructose 2,6-bisphosphate levels directly.
24363807 TIGAR is correlated with maximal standardized uptake value on FDG-PET and survival in non-small cell lung cancer.
24036271 CREB regulates TIGAR expression via a CRE-binding site at the TIGAR promoter.
23832602 TIGAR gene expression is down regulated by oxidative stress through the mediation of reactive oxygen species
23817040 data provide the first evidence that targeted silencing of TIGAR induces apoptotic and autophagic cell death in HepG2 cells
23726973 TIGAR has roles in efficient intestinal regeneration and tumorigenesis
23640457 TIGAR regulates akt and erk phosphorylation but hase no effect on NF-kappa B activation in neocazinostatin-treated cells.
23612020 oroxylin A could increase protein and mRNA expression of TP53-induced glycolysis and apoptosis regulator (TIGAR) and synthesis of cytochrome c oxidase 2 (SCO2), which are the key metabolic modulators regulated by p53.
23185017 The ability of TIGAR to function as a Fru-2,6-BPase was independent of hexokinase 2 binding and mitochondrial localization, although activities can contribute to the activity of TIGAR in limiting mitochondrial ROS levels and protecting from cell death.
22887998 Tp53-induced glycolysis and apoptosis regulator (TIGAR) protects glioma cells from starvation-induced cell death by up-regulating respiration and improving cellular redox homeostasis
22782351 TIGAR regulates the expression of genes involved in cell-cycle progression.
21864926 TIGAR abrogation provides a novel adjunctive therapeutic strategy against glial tumors by increasing radiation-induced cell impairment, thus allowing the use of lower radiotherapeutic doses.
21820150 These results suggest that p53 can modulate the metabolic pathways via the proteins SCO2 and TIGAR in human breast cancer.
21761199 SP1 can interact with the SP1-binding site within TIGAR promoter in vitro and in vivo. Conclusively, SPl is indispensable for basal activity of TIGAR promoter.
21057531 Inhibition of TIGAR by c-Met results in reduction of cellular NADPH and cell death.
19713938 TIGAR can modulate reactive oxygen species in response to nutrient starvation or metabolic stress, and functions to inhibit autophagy.
18945750 correlation between the recently described p53-inducible apoptosis gene TIGAR and both sensitivity to fludarabine and hENT2 expression in chronic lymphocytic leukemia cells.
16839880 The decrease of intracellular ROS levels in response to TIGAR may also play a role in the ability of p53 to protect from the accumulation of genomic damage.

AA Sequence

MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGIL      1 - 70
ERSKFCKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLC     71 - 140
QLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAYMRSLFDYFL    141 - 210
TDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDHLNGLTETR              211 - 270
//

Text Mined References (44)

PMID Year Title
26700591 2015 Upregulation of energy metabolism-related, p53-target TIGAR and SCO2 in HuH-7 cells with p53 mutation by geranylgeranoic acid treatment.
26691054 2016 Oncogenic role of the TP53-induced glycolysis and apoptosis regulator in nasopharyngeal carcinoma through NF-?B pathway modulation.
26675982 2016 Identification of the TP53-induced glycolysis and apoptosis regulator in various stages of colorectal cancer patients.
26191173 2015 TIGAR overexpression diminishes radiosensitivity of parotid gland fibroblast cells and inhibits IR-induced cell autophagy.
25928429 2015 TIGAR regulates DNA damage and repair through pentosephosphate pathway and Cdk5-ATM pathway.
25660220 2015 MiR-144 inhibits proliferation and induces apoptosis and autophagy in lung cancer cells by targeting TIGAR.
25085248 2014 TIGAR has a dual role in cancer cell survival through regulating apoptosis and autophagy.
24632713 2014 Targeting MUC1-C is synergistic with bortezomib in downregulating TIGAR and inducing ROS-mediated myeloma cell death.
24423178 2014 Identification of TP53-induced glycolysis and apoptosis regulator (TIGAR) as the phosphoglycolate-independent 2,3-bisphosphoglycerate phosphatase.
24363807 2013 TIGAR is correlated with maximal standardized uptake value on FDG-PET and survival in non-small cell lung cancer.
24036271 2013 CREB, another culprit for TIGAR promoter activity and expression.
23832602 2013 Reactive oxygen species-dependent down-regulation of tumor suppressor genes PTEN, USP28, DRAM, TIGAR, and CYLD under oxidative stress.
23817040 2013 Knockdown of TIGAR by RNA interference induces apoptosis and autophagy in HepG2 hepatocellular carcinoma cells.
23726973 2013 TIGAR is required for efficient intestinal regeneration and tumorigenesis.
23640457 2013 ATM-NF?B axis-driven TIGAR regulates sensitivity of glioma cells to radiomimetics in the presence of TNF?.
23612020 2013 Two p53-related metabolic regulators, TIGAR and SCO2, contribute to oroxylin A-mediated glucose metabolism in human hepatoma HepG2 cells.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23263487 2013 Genome-wide association analyses in East Asians identify new susceptibility loci for colorectal cancer.
23185017 2012 Mitochondrial localization of TIGAR under hypoxia stimulates HK2 and lowers ROS and cell death.
22887998 2012 Tp53-induced glycolysis and apoptosis regulator (TIGAR) protects glioma cells from starvation-induced cell death by up-regulating respiration and improving cellular redox homeostasis.
22782351 2012 TIGAR induces p53-mediated cell-cycle arrest by regulation of RB-E2F1 complex.
21864926 2011 TP53 induced glycolysis and apoptosis regulator (TIGAR) knockdown results in radiosensitization of glioma cells.
21820150 2012 Regulatory role of p53 in cancer metabolism via SCO2 and TIGAR in human breast cancer.
21761199 2012 SP1 plays a pivotal role for basal activity of TIGAR promoter in liver cancer cell lines.
21269460 2011 Initial characterization of the human central proteome.
21057531 2011 Inhibition of c-Met downregulates TIGAR expression and reduces NADPH production leading to cell death.
19713938 2009 Modulation of intracellular ROS levels by TIGAR controls autophagy.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19015259 2009 Structural and biochemical studies of TIGAR (TP53-induced glycolysis and apoptosis regulator).
18945750 2008 Identification of TIGAR in the equilibrative nucleoside transporter 2-mediated response to fludarabine in chronic lymphocytic leukemia cells.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
16839880 2006 TIGAR, a p53-inducible regulator of glycolysis and apoptosis.
16839873 2006 p53 and metabolism: Inside the TIGAR.
16381901 2006 The LIFEdb database in 2006.
16140933 2005 Identification of novel p53 target genes in ionizing radiation response.
16012775 2005 Comparative genomics on mammalian Fgf6-Fgf23 locus.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11062477 2000 Autosomal dominant hypophosphataemic rickets is associated with mutations in FGF23.
2442317 1987 Chemotherapy of metastatic seminoma: the Southeastern Cancer Study Group experience.