Property Summary

NCBI Gene PubMed Count 15
PubMed Score 7.03
PubTator Score 8.13

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96CG3
Symbols T2BP
T6BP
TIFAA

Gene

PDB

4YM4   4ZGI  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

PMID Text
26389808 This study reports the crystal structures of TIFA (residues 1-150, with the unstructured C-terminal tail truncated) and its complex with the N-terminal phosphothreonine9 peptide (residues 1-15).
26068852 an innate immune signaling axis, mediated by phosphorylation-dependent oligomerization of the TRAF-interacting protein with forkhead-associated domain (TIFA) that is triggered by heptose-1,7-bisphosphate.
22566686 identify a novel threonine phosphorylation site on TIFA and show that this phosphorylated threonine binds with the FHA domain of TIFA, leading to TIFA oligomerization and TIFA-mediated NF-kappaB activation
20332099 Observational study of gene-disease association. (HuGE Navigator)
15492226 TIFA induces the oligomerization and polyubiquitination of TRAF6, which leads to the activation of TAK1 and IKK through a proteasome-independent mechanism

AA Sequence

MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQF      1 - 70
SLQLFKKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQ     71 - 140
FILSPRSLLQENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES                              141 - 184
//

Text Mined References (20)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26389808 2015 Uncovering the Mechanism of Forkhead-Associated Domain-Mediated TIFA Oligomerization That Plays a Central Role in Immune Responses.
26068852 2015 INNATE IMMUNITY. Cytosolic detection of the bacterial metabolite HBP activates TIFA-dependent innate immunity.
25416956 2014 A proteome-scale map of the human interactome network.
22566686 2012 Intermolecular binding between TIFA-FHA and TIFA-pT mediates tumor necrosis factor alpha stimulation and NF-?B activation.
21269460 2011 Initial characterization of the human central proteome.
20332099 2010 A systematic gene-based screen of chr4q22-q32 identifies association of a novel susceptibility gene, DKK2, with the quantitative trait of alcohol dependence symptom counts.
16643855 2006 A novel Zinc finger protein, ZCCHC11, interacts with TIFA and modulates TLR signaling.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15492226 2004 TIFA activates IkappaB kinase (IKK) by promoting oligomerization and ubiquitination of TRAF6.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15047173 2004 TIFAB inhibits TIFA, TRAF-interacting protein with a forkhead-associated domain.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12566447 2003 Identification of TIFA as an adapter protein that links tumor necrosis factor receptor-associated factor 6 (TRAF6) to interleukin-1 (IL-1) receptor-associated kinase-1 (IRAK-1) in IL-1 receptor signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11798190 2002 T2BP, a novel TRAF2 binding protein, can activate NF-kappaB and AP-1 without TNF stimulation.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
1179819 1975 Plastic surgical rehabilitation of the prison patient.