Property Summary

NCBI Gene PubMed Count 42
PubMed Score 274.76
PubTator Score 82.55

Knowledge Summary

Patent (46,581)

Expression

  Differential Expression (16)

Disease log2 FC p
aldosterone-producing adenoma -1.086 1.2e-02
cystic fibrosis 1.179 1.2e-03
ductal carcinoma in situ -1.200 5.9e-03
gastric carcinoma 1.500 1.4e-02
interstitial cystitis 1.700 4.4e-05
invasive ductal carcinoma -1.800 2.5e-03
juvenile dermatomyositis 1.163 3.4e-07
lung adenocarcinoma -1.500 4.8e-19
lung cancer -1.400 2.0e-02
lung carcinoma -1.600 3.8e-10
malignant mesothelioma 3.800 2.0e-07
nephrosclerosis 1.157 1.9e-03
non-small cell lung cancer -2.339 1.8e-22
osteosarcoma -1.756 2.9e-02
pituitary cancer -1.300 1.4e-03
psoriasis -1.300 2.3e-04

 CSPA Cell Line (2)

Gene RIF (22)

AA Sequence

MVWRVPPFLLPILFLASHVGAAVDLTLLANLRLTDPQRFFLTCVSGEAGAGRGSDAWGPPLLLEKDDRIV      1 - 70
RTPPGPPLRLARNGSHQVTLRGFSKPSDLVGVFSCVGGAGARRTRVIYVHNSPGAHLLPDKVTHTVNKGD     71 - 140
TAVLSARVHKEKQTDVIWKSNGSYFYTLDWHEAQDGRFLLQLPNVQPPSSGIYSATYLEASPLGSAFFRL    141 - 210
IVRGCGAGRWGPGCTKECPGCLHGGVCHDHDGECVCPPGFTGTRCEQACREGRFGQSCQEQCPGISGCRG    211 - 280
LTFCLPDPYGCSCGSGWRGSQCQEACAPGHFGADCRLQCQCQNGGTCDRFSGCVCPSGWHGVHCEKSDRI    281 - 350
PQILNMASELEFNLETMPRINCAAAGNPFPVRGSIELRKPDGTVLLSTKAIVEPEKTTAEFEVPRLVLAD    351 - 420
SGFWECRVSTSGGQDSRRFKVNVKVPPVPLAAPRLLTKQSRQLVVSPLVSFSGDGPISTVRLHYRPQDST    421 - 490
MDWSTIVVDPSENVTLMNLRPKTGYSVRVQLSRPGEGGEGAWGPPTLMTTDCPEPLLQPWLEGWHVEGTD    491 - 560
RLRVSWSLPLVPGPLVGDGFLLRLWDGTRGQERRENVSSPQARTALLTGLTPGTHYQLDVQLYHCTLLGP    561 - 630
ASPPAHVLLPPSGPPAPRHLHAQALSDSEIQLTWKHPEALPGPISKYVVEVQVAGGAGDPLWIDVDRPEE    631 - 700
TSTIIRGLNASTRYLFRMRASIQGLGDWSNTVEESTLGNGLQAEGPVQESRAAEEGLDQQLILAVVGSVS    701 - 770
ATCLTILAALLTLVCIRRSCLHRRRTFTYQSGSGEETILQFSSGTLTLTRRPKLQPEPLSYPVLEWEDIT    771 - 840
FEDLIGEGNFGQVIRAMIKKDGLKMNAAIKMLKEYASENDHRDFAGELEVLCKLGHHPNIINLLGACKNR    841 - 910
GYLYIAIEYAPYGNLLDFLRKSRVLETDPAFAREHGTASTLSSRQLLRFASDAANGMQYLSEKQFIHRDL    911 - 980
AARNVLVGENLASKIADFGLSRGEEVYVKKTMGRLPVRWMAIESLNYSVYTTKSDVWSFGVLLWEIVSLG    981 - 1050
GTPYCGMTCAELYEKLPQGYRMEQPRNCDDEVYELMRQCWRDRPYERPPFAQIALQLGRMLEARKAYVNM   1051 - 1120
SLFENFTYAGIDATAEEA                                                       1121 - 1138
//

Text Mined References (45)

PMID Year Title