Property Summary

NCBI Gene PubMed Count 33
PubMed Score 11.56
PubTator Score 26.12

Knowledge Summary

Patent

No data available

Expression

 MGI Phenotype (1)

Protein-protein Interaction (11)

Gene RIF (17)

PMID Text
26408662 Data show that Toll/IL-1R domain-containing adaptor molecule (TICAM)-2 possesses two conserved acidic amino acids, D91 and E92, which regulate TICAM-2 self-activation and signaling.
25521228 Findings were SNPs in TICAM2 (P = 3.6 x 10(-6)) and IL1B (P = 4.3 x 10(-5)) associated with TB.
25385819 TRAM acts as a sorting adaptor not only for TLR4, but also for TLR2, to facilitate signaling to IRF7 at the endosome, which explains how TLR2 is capable of causing type I IFN induction.
25211222 TRAM plays a role in TLR7 signaling through a novel signaling axis towards the activation of anti-viral immunity.
24812060 A putative TRAF6-binding motif in TRAM may mediate a new TRAM function in TLR4 signaling in regulating inflammatory responses, distinct from its bridging TLR4 and TRIF. A TRAM E183A mutation abolished this.
24255114 The homotypic interaction between TICAM-2 TIR is indispensable to present a scaffold for recruiting the monomeric moiety of the TICAM-1 TIR dimer.
23136947 results suggest TLR adaptor molecules knockdown, such as MyD88 or TRAM, can decrease IL-6 and IL-8 mRNA and increase CXCL12 mRNA expression in HGF and HPDLF.
22970235 induction of both IL-6 and IL-8 is associated with elevated TIRAP and reduced TRAM mRNA expression
22685567 Data indicate that MyD88 works together with the IL-1/IL-18 receptors, can interact with two distinct sorting adaptors, TRAM and Mal, in a conserved manner.
20802145 viral inhibitor peptide of TLR4 possibly represents a surface domain of A46 that specifically inhibits TLR4 by masking critical binding sites on MyD88 adaptor-like and TRIF-related adaptor molecule
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19543401 Observational study of gene-disease association. (HuGE Navigator)
19412184 TAG is a splice variant of TRAM. TAG inhibits TRAM by displacing TRIF, and TAG overexpression specifically inhibits TLR4 signaling.
18297073 TRAM functions as a sorting adaptor that controls the initiation of TRIF/TICAM1-dependent signaling from an endosomal compartment; TRAM seems to be required for Toll-like receptor-4 coupling on the cell surface to the endosomal activation of TRIF-TRAF3.
16603631 The myristoylation of TRAM targets it to the plasma membrane, where it is essential for LPS responses through the TLR4 signal transduction pathway.
14519765 the adapter complex of TICAM-2 and TICAM-1 plays a crucial role in lipopolysaccharide-TLR4-mediated activation of IFN-beta
12721283 Overexpression of TIRP activates NF-kappaB and potentiates IL-1 receptor-mediated NF-kappaB activation

AA Sequence

MGIGKSKINSCPLSLSWGKRHSVDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFE      1 - 70
EEAEEEVFLKFVILHAEDDTDEALRVQNLLQDDFGIKPGIIFAEMPCGRQHLQNLDDAVNGSAWTILLLT     71 - 140
ENFLRDTWCNFQFYTSLMNSVNRQHKYNSVIPMRPLNNPLPRERTPFALQTINALEEESRGFPTQVERIF    141 - 210
QESVYKTQQTIWKETRNMVQRQFIA                                                 211 - 235
//

Text Mined References (36)

PMID Year Title
26592460 2016 SARM modulates MyD88-mediated TLR activation through BB-loop dependent TIR-TIR interactions.
26408662 2015 Identification of a Regulatory Acidic Motif as the Determinant of Membrane Localization of TICAM-2.
25736436 2015 WDFY1 mediates TLR3/4 signaling by recruiting TRIF.
25521228 2015 Polymorphisms in TICAM2 and IL1B are associated with TB.
25416956 2014 A proteome-scale map of the human interactome network.
25385819 2014 TRAM is required for TLR2 endosomal signaling to type I IFN induction.
25211222 2014 The TIR-domain containing adaptor TRAM is required for TLR7 mediated RANTES production.
24812060 2014 The TLR signaling adaptor TRAM interacts with TRAF6 to mediate activation of the inflammatory response by TLR4.
24255114 2013 Structures and interface mapping of the TIR domain-containing adaptor molecules involved in interferon signaling.
23136947 2013 MyD88 or TRAM knockdown regulates interleukin (IL)-6, IL-8, and CXCL12 mRNA expression in human gingival and periodontal ligament fibroblasts.
22970235 2012 Human cytomegalovirus induces TLR4 signaling components in monocytes altering TIRAP, TRAM and downstream interferon-beta and TNF-alpha expression.
22685567 2012 TRAM is involved in IL-18 signaling and functions as a sorting adaptor for MyD88.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
20802145 2010 Viral inhibitory peptide of TLR4, a peptide derived from vaccinia protein A46, specifically inhibits TLR4 by directly targeting MyD88 adaptor-like and TRIF-related adaptor molecule.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19543401 2009 Toll-like receptor polymorphisms and susceptibility to urinary tract infections in adult women.
19412184 2009 TAG, a splice variant of the adaptor TRAM, negatively regulates the adaptor MyD88-independent TLR4 pathway.
18810425 2008 Natural selection in the TLR-related genes in the course of primate evolution.
18297073 2008 TRAM couples endocytosis of Toll-like receptor 4 to the induction of interferon-beta.
17372010 2007 Evidence for evolving Toll-IL-1 receptor-containing adaptor molecule function in vertebrates.
17258210 2007 MAPPIT analysis of TLR adaptor complexes.
16757566 2006 Trif-related adapter molecule is phosphorylated by PKC{epsilon} during Toll-like receptor 4 signaling.
16603631 2006 The myristoylation of TRIF-related adaptor molecule is essential for Toll-like receptor 4 signal transduction.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16115877 2005 Rip1 mediates the Trif-dependent toll-like receptor 3- and 4-induced NF-{kappa}B activation but does not contribute to interferon regulatory factor 3 activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
14556004 2003 TRAM is specifically involved in the Toll-like receptor 4-mediated MyD88-independent signaling pathway.
14519765 2003 TIR-containing adapter molecule (TICAM)-2, a bridging adapter recruiting to toll-like receptor 4 TICAM-1 that induces interferon-beta.
14517278 2003 LPS-TLR4 signaling to IRF-3/7 and NF-kappaB involves the toll adapters TRAM and TRIF.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12721283 2003 TIRP, a novel Toll/interleukin-1 receptor (TIR) domain-containing adapter protein involved in TIR signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.
9490301 1998 Cloning and tissue expression of cDNAs from chromosome 5q21-22 which is frequently deleted in advanced lung cancer.