Property Summary

NCBI Gene PubMed Count 98
PubMed Score 31.81
PubTator Score 135.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma -1.400 2.7e-05
medulloblastoma, large-cell -1.200 2.1e-03

 GWAS Trait (1)

Protein-protein Interaction (11)

Gene RIF (73)

PMID Text
26646717 Using bone marrow derived macrophages from knockout mice we demonstrate that hBD3 suppresses the polyI:C-induced TLR3 response mediated by TICAM1 (TRIF), while exacerbating the cytoplasmic response through MDA5 (IFIH1) and MAVS (IPS1/CARDIF).
26195481 In mice with nonfunctional TRIF (Trif(mut) mice), Ang II-induced hypertension and cardiac hypertrophy were abrogated, and proinflammatory gene expression in heart and kidneys was unchanged or decreased. These results indicate that Ang II induces activation of a proinflammatory innate immune response, causing hypertension and cardiac hypertrophy, which require functional adaptor protein TRIF-mediated pathways.
26100679 signaling through TRIF is important for the inflammatory response of AngII-induced abdominal aortic aneurysm formation
26056004 TRIF promotes angiotensin II-induced cross-talk between fibroblasts and macrophages in atrial fibrosis.
25754842 Data show that toll-like receptor 3/TRIF protein signalling regulates cytokines IL-32 and IFN-beta secretion by activation of receptor-interacting protein-1 (RIP-1) and tumour necrosis factor receptor-associated factor 6 (TRAF6) in cornea epithelial cells.
25736436 WDFY1 mediates TLR3/TLR4 signaling by recruiting TRIF.
25636800 findings show that TRIF activates IRF3 through a phosphorylation-dependent mechanism; results reveal that phosphorylation of innate adaptor proteins is an essential and conserved mechanism that selectively recruits IRF3 to activate the type I IFN pathway
25377948 involved in signaling that moderates the expression of heme oxygenase1 and il-8 after keratinocytes exposure to dinitrochlorobenzene
25049357 PTX3 binds MD-2 and promotes TRIF-dependent immune protection in aspergillosis.
24693944 MUC1 has a role in regulating epithelial inflammation and apoptosis by PolyI:C through inhibition of TRIF recruitment to Toll-like receptor 3
24672048 Enterovirus 68 3C protease cleaves TRIF to attenuate antiviral responses mediated by TLR3.
24577058 amino-terminal 21 amino acid sequence is crucial for TRAF3 association, protein stability and activation of the IFN pathway
24311583 TRIF-N-terminal helical domain shares structural similarity with IFIT5.
24129891 IL-32-PAR2 axis is an innate immunity sensor providing alternative signaling for LPS-TRIF axis.
23941760 required, in combination with MyD88, for TLR4-mediated proinflammatory dendritic cell differentiation
23824566 required for HLA class I antigen presentation during Hantavirus infection
23723066 Data indicate that TIR domain containing adaptor inducing IFN-beta protein (TRIF), as well as TLR3 activation, enhances Kaposi's sarcoma-associated herpesvirus (KSHV) replication and transcription activator (RTA) protein expression.
23673637 The TLR9-TRIF circuit--but not MyD88 signalling--was required for CpG protection against allergic inflammation.
23365087 ADAM15 acts as a negative regulator of TRIF-mediated NF-kappaB and IFN-beta reporter gene activity via TLR3 and TLR4 signaling.
23056470 TRIM38 may act as a novel negative regulator for TLR3-mediated type I interferon signaling by targeting TRIF for degradation
22964479 anti-beta(2)GPI/beta(2)GPI complex induced TF and TNF-alpha expression involving both TLR4/MyD88 and TLR4/TRIF signaling pathways and TLR4 and its adaptors might be molecular targets for therapy of antiphospholipid syndrome
22870331 Canine hepacivirus NS3 serine protease can cleave the human adaptor proteins MAVS and TRIF.
22474023 the D299G polymorphism compromises recruitment of MyD88 and TRIF to TLR4 without affecting TLR4 expression, TLR4-MD2 interaction, or LPS binding, suggesting that it interferes with TLR4 dimerization
22337809 Data show that The TRIF-selective signaling response resulted in the production of substantially less of the proinflammatory mediators.
22205631 TICAM1 down-regulation was found to be dependent on TLR3 but not RIG1, MDA5, or PKR and appeared to be regulated post-translationally
22152804 TRIF may play an important role in the pathogenesis of antiphospholipid syndrome.
22105173 Susceptibility to herpes simplex encephalitis is caused by TRIF nonsense (autosomal recessive) TRIF deficiency or a missense mutation (autosomal dominant). TRIf is needed for TLR3-dependent interferon synthesis.
22095710 The TLR2/4 ligand biglycan enhances antigen-specific T cell priming via MyD88 and Toll-like receptor adapter molecule TRIF pathways, triggering autoimmune perimyocarditis in transgenic mice.
22043923 regulation of the TLR3/TRIF-mediated pathway required the combined action of SHP-1 and SHP-2, which could be accomplished by CD300f but not CD300a
21998457 The host TICAM-1 transgene pathway is essential for antiviral responses that suppress poliovirus infection, which is exacerbated in TICAM-1-deficient poliovirus receptor-bearing mice.
21931545 Hepatitis A virus inhibits TLR3 signaling by reducing abundance of the adaptor protein TRIF.
21809339 show that hBD3 reduces NF-kappaB signaling in cells transfected with MyD88 or TRIF
21792053 These studies establish that MyD88 but not Trif signaling plays a critical role in mediating cardiac dysfunction, systemic inflammation, and mortality during polymicrobial sepsis
21697485 TRIF cleavage mediated by human enterovirus 71 3C protease may be a mechanism to impair type I interferon production in response to Toll-like receptor 3 (TLR3) activation.
21695056 PLIC-1 is a novel inhibitor of the TLR3-Trif antiviral pathway by reducing the abundance of Trif
21536801 Data indicate that CD300F is an active regulator of TLR-mediated macrophage activation through association with SHP-1 involving MyD88 and/or TRIF.
21324962 RA synovium showed abundant expression of TLR. RA synovitis tissue seems to be responsive to TLR ligands.
21212282 KSHV employs a novel mechanism to block the innate immunity by degrading TRIF protein.
21148036 TRIF protein induces soluble tumor necrosis factor receptor 1 (TNFR1) shedding via signaling from human airway epithelial cells (NCI-H292) with subsequent activation of two downstream pathways.
21048031 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20855887 Silencing TRIF expression reduces TLR5-induced NFkappaB, JNK1/2, and ERK1/2 activation in human colonic epithelial cells.
20588308 Observational study of gene-disease association. (HuGE Navigator)
20452988 TRIF modulates TLR5-dependent responses by inducing proteolytic degradation of TLR5
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20418377 Data show that mutant TICAM-1 failed to recruit the IRF-3 kinase TBK1, resulting in lack of IRF-3 phosphorylation.
20406964 Observational study of gene-disease association. (HuGE Navigator)
20375303 Consistent with results for total tumor necrosis factor (TNF)-alpha messenger RNA (mRNA) levels, lipopolysaccharide-stimulated Trif transgenic and wild-type bone marrow-derived dendritic cells generate comparable amounts of TNF-alpha transcripts.
20331378 Observational study of gene-disease association. (HuGE Navigator)
20306472 SARM-mediated inhibition may not be exclusively directed at TRIF or MyD88, but that SARM may also directly inhibit MAPK phosphorylation
20200155 TRIS was associated with TRIF upon TLR3 activation by poly(I-C). These findings reveal an unexpected mechanism of TLR3-mediated signaling.
20047764 The binding of TRAF2 and TRAF6 to TICAM-1 cooperatively activates the IFN-inducing pathway through ubiquitination of TICAM-1.
19795416 Knockdown of BS69 resulted in a decrease of IFN-beta induction, suggesting that BS69 is a positive regulator for the TLR3-TICAM-1 pathway and negative regulatory properties in NF-kappaB activation.
19656901 dysregulation of TLR4-triggered MyD88- and TRIF-dependent signaling pathways and increased expression of negative regulators of TLR signaling in endotoxin-tolerant human monocytes.
19543401 Observational study of gene-disease association. (HuGE Navigator)
19423540 Observational study of gene-disease association. (HuGE Navigator)
19028691 PKR, in addition to IPS-1 and IRF3 but not TRIF, was required for maximal type I IFN-beta induction and the induction of apoptosis by both transfected PRNAs and polyinosinic-polycytidylic acid.
18987746 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18756281 Inactivation of Trif and Cardif can also occur through cellular caspases activated by various pro-apoptotic signals.
18571728 PTP1B is a physiological negative regulator of TLR signaling via suppression of both MyD88- and TRIF-dependent production of proinflammatory cytokine and IFN-beta in macrophages.
18450748 activation and formation of TICAM-1 signalosomes with NF-kappaB and interferon regulatory factor-3 requires oligomerization induced at two different sites and RIP1 binding
17982077 the spatiotemporal mobilization of TICAM-1 in response to dsRNA and the formation of the TICAM-1 speckles containing RIP1 and NAP1 are important for the activation of the TLR3-TICAM-1 pathway.
16964262 SARM associated with TRIF, and 'knockdown' of endogenous SARM expression by interfering RNA led to enhanced TRIF-dependent cytokine and chemokine induction.
15814722 TRIF-induced cell death required caspase activity initiated by the Fas/Apo-1-associated DD protein-caspase-8 axis
15767257 studies of the molecular properties of TRIF which contribute to its ability to function as a substrate for the NS3/4A protease; a polyproline II interaction with the 3(10) helix likely facilitates NS3/4A recognition of TRIF
15251447 TRIF-induced ISRE and NF-kappaB activation are inhibited by PIASy
14982987 double-stranded RNA-induced TLR3/TRIF-mediated NF-kappaB and IRF3 activation diverge at TRIF
14960149 TRIF has a distal region with the ability to negatively regulate basal transcription & a proximal region containing an Sp1 site that confers approx. 75% of basal transcriptional activity. TRIF appears to be regulated primarily by NF-kappaB.
14739303 the TRIF-induced IFN-stimulated response element and NF-kappaB activation and apoptosis pathways are uncoupled
14530355 TRIF associates with TNF receptor-associated factor 6 (TRAF6) and TANK-binding kinase (TBK)-1 independently and activates two distinct transcription factors, NF-kappa B and IFN regulatory factor-3, respectively.
14519765 the adapter complex of TICAM-2 and TICAM-1 plays a crucial role in lipopolysaccharide-TLR4-mediated activation of IFN-beta
14517278 LPS-TLR4 signaling to IRF-3/7 and NF-kappaB involves the toll adapters TRAM and TRIF.
12539043 identified an alternative adaptor, designated Toll-interleukin 1 receptor domain (TIR)-containing adaptor molecule (TICAM)-1, that can physically bind the TIR domain of TLR3
12471095 TRIF is identified and characterized as a novel adaptor protein containing the Toll/IL-1 receptor domain, with a specific role in TLR3 signaling.

AA Sequence

MACTGPSLPSAFDILGAAGQDKLLYLKHKLKTPRPGCQGQDLLHAMVLLKLGQETEARISLEALKADAVA      1 - 70
RLVARQWAGVDSTEDPEEPPDVSWAVARLYHLLAEEKLCPASLRDVAYQEAVRTLSSRDDHRLGELQDEA     71 - 140
RNRCGWDIAGDPGSIRTLQSNLGCLPPSSALPSGTRSLPRPIDGVSDWSQGCSLRSTGSPASLASNLEIS    141 - 210
QSPTMPFLSLHRSPHGPSKLCDDPQASLVPEPVPGGCQEPEEMSWPPSGEIASPPELPSSPPPGLPEVAP    211 - 280
DATSTGLPDTPAAPETSTNYPVECTEGSAGPQSLPLPILEPVKNPCSVKDQTPLQLSVEDTTSPNTKPCP    281 - 350
PTPTTPETSPPPPPPPPSSTPCSAHLTPSSLFPSSLESSSEQKFYNFVILHARADEHIALRVREKLEALG    351 - 420
VPDGATFCEDFQVPGRGELSCLQDAIDHSAFIILLLTSNFDCRLSLHQVNQAMMSNLTRQGSPDCVIPFL    421 - 490
PLESSPAQLSSDTASLLSGLVRLDEHSQIFARKVANTFKPHRLQARKAMWRKEQDTRALREQSQHLDGER    491 - 560
MQAAALNAAYSAYLQSYLSYQAQMEQLQVAFGSHMSFGTGAPYGARMPFGGQVPLGAPPPFPTWPGCPQP    561 - 630
PPLHAWQAGTPPPPSPQPAAFPQSLPFPQSPAFPTASPAPPQSPGLQPLIIHHAQMVQLGLNNHMWNQRG    631 - 700
SQAPEDKTQEAE                                                              701 - 712
//

Text Mined References (103)

PMID Year Title
26646717 2015 Human ?-Defensin 3 [corrected] Exacerbates MDA5 but Suppresses TLR3 Responses to the Viral Molecular Pattern Mimic Polyinosinic:Polycytidylic Acid.
26195481 2015 Dual Activation of TRIF and MyD88 Adaptor Proteins by Angiotensin II Evokes Opposing Effects on Pressure, Cardiac Hypertrophy, and Inflammatory Gene Expression.
26100679 2015 TRIF adaptor signaling is important in abdominal aortic aneurysm formation.
26056004 2015 TRIF promotes angiotensin II-induced cross-talk between fibroblasts and macrophages in atrial fibrosis.
25754842 2015 TLR3/TRIF signalling pathway regulates IL-32 and IFN-? secretion through activation of RIP-1 and TRAF in the human cornea.
25736436 2015 WDFY1 mediates TLR3/4 signaling by recruiting TRIF.
25636800 2015 Phosphorylation of innate immune adaptor proteins MAVS, STING, and TRIF induces IRF3 activation.
25377948 2016 The involvement of the Toll-like receptor signaling and Nrf2-Keap1 pathways in the in vitro regulation of IL-8 and HMOX1 for skin sensitization.
25049357 2014 PTX3 binds MD-2 and promotes TRIF-dependent immune protection in aspergillosis.
24693944 2014 MUC1 regulates epithelial inflammation and apoptosis by PolyI:C through inhibition of Toll/IL-1 receptor-domain-containing adapter-inducing IFN-? (TRIF) recruitment to Toll-like receptor 3.
24672048 2014 Enterovirus 68 3C protease cleaves TRIF to attenuate antiviral responses mediated by Toll-like receptor 3.
24577058 2014 A new domain in the Toll/IL-1R domain-containing adaptor inducing interferon-? factor protein amino terminus is important for tumor necrosis factor-? receptor-associated factor 3 association, protein stabilization and interferon signaling.
24311583 2013 The TLR signalling adaptor TRIF/TICAM-1 has an N-terminal helical domain with structural similarity to IFIT proteins.
24129891 2013 IL-32-PAR2 axis is an innate immunity sensor providing alternative signaling for LPS-TRIF axis.
23941760 2014 TLR4-mediated pro-inflammatory dendritic cell differentiation in humans requires the combined action of MyD88 and TRIF.
23824566 2013 Hantaviral mechanisms driving HLA class I antigen presentation require both RIG-I and TRIF.
23723066 2013 TLR-TRIF pathway enhances the expression of KSHV replication and transcription activator.
23673637 2013 High doses of CpG oligodeoxynucleotides stimulate a tolerogenic TLR9-TRIF pathway.
23365087 2013 TRIF-mediated TLR3 and TLR4 signaling is negatively regulated by ADAM15.
23056470 2012 TRIM38 negatively regulates TLR3-mediated IFN-? signaling by targeting TRIF for degradation.
22964479 2013 Anti-?(2)GPI/?(2)GPI induced TF and TNF-? expression in monocytes involving both TLR4/MyD88 and TLR4/TRIF signaling pathways.
22948160 2012 TRIM56 is an essential component of the TLR3 antiviral signaling pathway.
22870331 2012 Canine hepacivirus NS3 serine protease can cleave the human adaptor proteins MAVS and TRIF.
22561518 2012 Genome-wide association analyses identify 13 new susceptibility loci for generalized vitiligo.
22474023 2012 The Asp299Gly polymorphism alters TLR4 signaling by interfering with recruitment of MyD88 and TRIF.
22337809 2012 Selective TRIF-dependent signaling by a synthetic toll-like receptor 4 agonist.
22205631 2012 Negative control of TLR3 signaling by TICAM1 down-regulation.
22152804 2011 [The activation of TRIF-dependent signaling pathway in THP-1 cells induced by ?? GPI/anti-?? GPI antibodies complex].
22105173 2011 Herpes simplex encephalitis in children with autosomal recessive and dominant TRIF deficiency.
22095710 2011 The proteoglycan biglycan enhances antigen-specific T cell activation potentially via MyD88 and TRIF pathways and triggers autoimmune perimyocarditis.
22043923 2012 CD300a and CD300f differentially regulate the MyD88 and TRIF-mediated TLR signalling pathways through activation of SHP-1 and/or SHP-2 in human monocytic cell lines.
21998457 2011 The TLR3/TICAM-1 pathway is mandatory for innate immune responses to poliovirus infection.
21931545 2011 Disruption of TLR3 signaling due to cleavage of TRIF by the hepatitis A virus protease-polymerase processing intermediate, 3CD.
21809339 2011 Human ?-defensin 3 affects the activity of pro-inflammatory pathways associated with MyD88 and TRIF.
21792053 2011 MyD88 and Trif signaling play distinct roles in cardiac dysfunction and mortality during endotoxin shock and polymicrobial sepsis.
21737330 2011 cIAPs block Ripoptosome formation, a RIP1/caspase-8 containing intracellular cell death complex differentially regulated by cFLIP isoforms.
21697485 2011 Cleavage of the adaptor protein TRIF by enterovirus 71 3C inhibits antiviral responses mediated by Toll-like receptor 3.
21695056 2011 The ubiquitin-like protein PLIC-1 or ubiquilin 1 inhibits TLR3-Trif signaling.
21536801 2011 CD300F blocks both MyD88 and TRIF-mediated TLR signaling through activation of Src homology region 2 domain-containing phosphatase 1.
21324962 2011 Expression of Toll-like receptors and their signaling pathways in rheumatoid synovitis.
21266579 2011 Raftlin is involved in the nucleocapture complex to induce poly(I:C)-mediated TLR3 activation.
21212282 2011 Kaposi sarcoma-associated herpesvirus degrades cellular Toll-interleukin-1 receptor domain-containing adaptor-inducing beta-interferon (TRIF).
21148036 2011 Double-stranded RNA induces shedding of the 34-kDa soluble TNFR1 from human airway epithelial cells via TLR3-TRIF-RIP1-dependent signaling: roles for dual oxidase 2- and caspase-dependent pathways.
21048031 2011 Single nucleotide polymorphisms of matrix metalloproteinase 9 (MMP9) and tumor protein 73 (TP73) interact with Epstein-Barr virus in chronic lymphocytic leukemia: results from the European case-control study EpiLymph.
20855887 2010 TRIF mediates Toll-like receptor 5-induced signaling in intestinal epithelial cells.
20588308 2010 Dengue hemorrhagic fever is associated with polymorphisms in JAK1.
20452988 2010 TRIF modulates TLR5-dependent responses by inducing proteolytic degradation of TLR5.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20418377 2010 A molecular mechanism for Toll-IL-1 receptor domain-containing adaptor molecule-1-mediated IRF-3 activation.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20375303 2010 TRIF signaling stimulates translation of TNF-alpha mRNA via prolonged activation of MK2.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20306472 2010 SARM inhibits both TRIF- and MyD88-mediated AP-1 activation.
20200155 2010 Analysis of a TIR-less splice variant of TRIF reveals an unexpected mechanism of TLR3-mediated signaling.
20047764 2010 Direct binding of TRAF2 and TRAF6 to TICAM-1/TRIF adaptor participates in activation of the Toll-like receptor 3/4 pathway.
19795416 2009 Oligomerized TICAM-1 (TRIF) in the cytoplasm recruits nuclear BS69 to enhance NF-kappaB activation and type I IFN induction.
19656901 2009 Endotoxin tolerance dysregulates MyD88- and Toll/IL-1R domain-containing adapter inducing IFN-beta-dependent pathways and increases expression of negative regulators of TLR signaling.
19543401 2009 Toll-like receptor polymorphisms and susceptibility to urinary tract infections in adult women.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19028691 2009 The RNA-activated protein kinase enhances the induction of interferon-beta and apoptosis mediated by cytoplasmic RNA sensors.
18987746 2008 Association of interacting genes in the toll-like receptor signaling pathway and the antibody response to pertussis vaccination.
18810425 2008 Natural selection in the TLR-related genes in the course of primate evolution.
18756281 2008 The antiviral adaptor proteins Cardif and Trif are processed and inactivated by caspases.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18571728 2008 Phosphatase PTP1B negatively regulates MyD88- and TRIF-dependent proinflammatory cytokine and type I interferon production in TLR-triggered macrophages.
18450748 2008 Homo-oligomerization is essential for Toll/interleukin-1 receptor domain-containing adaptor molecule-1-mediated NF-kappaB and interferon regulatory factor-3 activation.
18442983 2008 Cytomegalovirus M45 cell death suppression requires receptor-interacting protein (RIP) homotypic interaction motif (RHIM)-dependent interaction with RIP1.
17982077 2007 Spatiotemporal mobilization of Toll/IL-1 receptor domain-containing adaptor molecule-1 in response to dsRNA.
17457343 2007 The family of five: TIR-domain-containing adaptors in Toll-like receptor signalling.
16964262 2006 The human adaptor SARM negatively regulates adaptor protein TRIF-dependent Toll-like receptor signaling.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16306936 2006 Critical role of TRAF3 in the Toll-like receptor-dependent and -independent antiviral response.
16153868 2005 VISA is an adapter protein required for virus-triggered IFN-beta signaling.
16115877 2005 Rip1 mediates the Trif-dependent toll-like receptor 3- and 4-induced NF-{kappa}B activation but does not contribute to interferon regulatory factor 3 activation.
16052631 2005 TRAF4 acts as a silencer in TLR-mediated signaling through the association with TRAF6 and TRIF.
15940673 2005 Inhibition of phosphoinositide 3-kinase enhances TRIF-dependent NF-kappa B activation and IFN-beta synthesis downstream of Toll-like receptor 3 and 4.
15814722 2005 Apoptosis induced by the toll-like receptor adaptor TRIF is dependent on its receptor interacting protein homotypic interaction motif.
15767257 2005 Molecular determinants of TRIF proteolysis mediated by the hepatitis C virus NS3/4A protease.
15611223 2005 Cutting Edge: NF-kappaB-activating kinase-associated protein 1 participates in TLR3/Toll-IL-1 homology domain-containing adapter molecule-1-mediated IFN regulatory factor 3 activation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15474016 2004 A20 is a potent inhibitor of TLR3- and Sendai virus-induced activation of NF-kappaB and ISRE and IFN-beta promoter.
15276183 2004 MD-2: the Toll 'gatekeeper' in endotoxin signalling.
15251447 2004 PIASy represses TRIF-induced ISRE and NF-kappaB activation but not apoptosis.
15142865 2004 A20 inhibits toll-like receptor 2- and 4-mediated interleukin-8 synthesis in airway epithelial cells.
15064760 2004 RIP1 is an essential mediator of Toll-like receptor 3-induced NF-kappa B activation.
14982987 2004 Toll-like receptor 3-mediated activation of NF-kappaB and IRF3 diverges at Toll-IL-1 receptor domain-containing adapter inducing IFN-beta.
14960149 2004 Transcriptional regulation of the human TRIF (TIR domain-containing adaptor protein inducing interferon beta) gene.
14739303 2004 Mechanisms of the TRIF-induced interferon-stimulated response element and NF-kappaB activation and apoptosis pathways.
14556004 2003 TRAM is specifically involved in the Toll-like receptor 4-mediated MyD88-independent signaling pathway.
14530355 2003 Toll/IL-1 receptor domain-containing adaptor inducing IFN-beta (TRIF) associates with TNF receptor-associated factor 6 and TANK-binding kinase 1, and activates two distinct transcription factors, NF-kappa B and IFN-regulatory factor-3, in the Toll-like receptor signaling.
14519765 2003 TIR-containing adapter molecule (TICAM)-2, a bridging adapter recruiting to toll-like receptor 4 TICAM-1 that induces interferon-beta.
14517278 2003 LPS-TLR4 signaling to IRF-3/7 and NF-kappaB involves the toll adapters TRAM and TRIF.
12855817 2003 Role of adaptor TRIF in the MyD88-independent toll-like receptor signaling pathway.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12721283 2003 TIRP, a novel Toll/interleukin-1 receptor (TIR) domain-containing adapter protein involved in TIR signaling.
12692549 2003 IKKepsilon and TBK1 are essential components of the IRF3 signaling pathway.
12609980 2003 Poly(I-C)-induced Toll-like receptor 3 (TLR3)-mediated activation of NFkappa B and MAP kinase is through an interleukin-1 receptor-associated kinase (IRAK)-independent pathway employing the signaling components TLR3-TRAF6-TAK1-TAB2-PKR .
12539043 2003 TICAM-1, an adaptor molecule that participates in Toll-like receptor 3-mediated interferon-beta induction.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12471095 2002 Cutting edge: a novel Toll/IL-1 receptor domain-containing adapter that preferentially activates the IFN-beta promoter in the Toll-like receptor signaling.
10066798 1999 pp60(v-src) induction of cyclin D1 requires collaborative interactions between the extracellular signal-regulated kinase, p38, and Jun kinase pathways. A role for cAMP response element-binding protein and activating transcription factor-2 in pp60(v-src) signaling in breast cancer cells.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.