Property Summary

NCBI Gene PubMed Count 12
PubMed Score 14.70
PubTator Score 20.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 3.2e-02
posterior fossa group B ependymoma -2.800 2.2e-13
oligodendroglioma -2.000 1.2e-02
glioblastoma -2.000 9.6e-05
group 4 medulloblastoma -3.000 3.9e-06
atypical teratoid / rhabdoid tumor -1.800 5.1e-03
medulloblastoma, large-cell -2.700 9.5e-05
primitive neuroectodermal tumor -1.700 1.3e-02
tuberculosis -1.400 2.6e-04
adult high grade glioma -1.500 6.6e-03
subependymal giant cell astrocytoma -1.780 4.0e-02
psoriasis -1.800 3.4e-14
ovarian cancer -1.900 5.7e-08

Gene RIF (6)

PMID Text
24377522 Knockdown of TIAM2 could up-regulate the expression of E-cadherin.
21469146 TIAM2 expression was undetectable in normal human liver but was induced in all HCC cell lines and in 86% (78/91) of HCC biopsies.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of T-cell lymphoma invasion and metastasis 2 (TIAM2) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
11900975 stef gene expressed in a stage- and region-specific manner in the mouse brain
10364228 STEF protein is a guanine nucleotide exchange factor that specifically activates Rac1 in vitro and in cultured cells, which may lead to changes in the actin cytoskeletal network.

AA Sequence

MGNSDSQYTLQGSKNHSNTITGAKQIPCSLKIRGIHAKEEKSLHGWGHGSNGAGYKSRSLARSCLSHFKS      1 - 70
NQPYASRLGGPTCKVSRGVAYSTHRTNAPGKDFQGISAAFSTENGFHSVGHELADNHITSRDCNGHLLNC     71 - 140
YGRNESIASTPPGEDRKSPRVLIKTLGKLDGCLRVEFHNGGNPSKVPAEDCSEPVQLLRYSPTLASETSP    141 - 210
VPEARRGSSADSLPSHRPSPTDSRLRSSKGSSLSSESSWYDSPWGNAGELSEAEGSFLAPGMPDPSLHAS    211 - 280
FPPGDAKKPFNQSSSLSSLRELYKDANLGSLSPSGIRLSDEYMGTHASLSNRVSFASDIDVPSRVAHGDP    281 - 350
IQYSSFTLPCRKPKAFVEDTAKKDSLKARMRRISDWTGSLSRKKRKLQEPRSKEGSDYFDSRSDGLNTDV    351 - 420
QGSSQASAFLWSGGSTQILSQRSESTHAIGSDPLRQNIYENFMRELEMSRTNTENIETSTETAESSSESL    421 - 490
SSLEQLDLLFEKEQGVVRKAGWLFFKPLVTVQKERKLELVARRKWKQYWVTLKGCTLLFYETYGKNSMDQ    491 - 560
SSAPRCALFAEDSIVQSVPEHPKKENVFCLSNSFGDVYLFQATSQTDLENWVTAVHSACASLFAKKHGKE    561 - 630
DTLRLLKNQTKNLLQKIDMDSKMKKMAELQLSVVSDPKNRKAIENQIQQWEQNLEKFHMDLFRMRCYLAS    631 - 700
LQGGELPNPKSLLAAASRPSKLALGRLGILSVSSFHALVCSRDDSALRKRTLSLTQRGRNKKGIFSSLKG    701 - 770
LDTLARKGKEKRPSITQVDELLHIYGSTVDGVPRDNAWEIQTYVHFQDNHGVTVGIKPEHRVEDILTLAC    771 - 840
KMRQLEPSHYGLQLRKLVDDNVEYCIPAPYEYMQQQVYDEIEVFPLNVYDVQLTKTGSVCDFGFAVTAQV    841 - 910
DERQHLSRIFISDVLPDGLAYGEGLRKGNEIMTLNGEAVSDLDLKQMEALFSEKSVGLTLIARPPDTKAT    911 - 980
LCTSWSDSDLFSRDQKSLLPPPNQSQLLEEFLDNFKKNTANDFSNVPDITTGLKRSQTDGTLDQVSHREK    981 - 1050
MEQTFRSAEQITALCRSFNDSQANGMEGPRENQDPPPRSLARHLSDADRLRKVIQELVDTEKSYVKDLSC   1051 - 1120
LFELYLEPLQNETFLTQDEMESLFGSLPEMLEFQKVFLETLEDGISASSDFNTLETPSQFRKLLFSLGGS   1121 - 1190
FLYYADHFKLYSGFCANHIKVQKVLERAKTDKAFKAFLDARNPTKQHSSTLESYLIKPVQRVLKYPLLLK   1191 - 1260
ELVSLTDQESEEHYHLTEALKAMEKVASHINEMQKIYEDYGTVFDQLVAEQSGTEKEVTELSMGELLMHS   1261 - 1330
TVSWLNPFLSLGKARKDLELTVFVFKRAVILVYKENCKLKKKLPSNSRPAHNSTDLDPFKFRWLIPISAL   1331 - 1400
QVRLGNPAGTENNSIWELIHTKSEIEGRPETIFQLCCSDSESKTNIVKVIRSILRENFRRHIKCELPLEK   1401 - 1470
TCKDRLVPLKNRVPVSAKLASSRSLKVLKNSSSNEWTGETGKGTLLDSDEGSLSSGTQSSGCPTAEGRQD   1471 - 1540
SKSTSPGKYPHPGLADFADNLIKESDILSDEDDDHRQTVKQGSPTKDIEIQFQRLRISEDPDVHPEAEQQ   1541 - 1610
PGPESGEGQKGGEQPKLVRGHFCPIKRKANSTKRDRGTLLKAQIRHQSLDSQSENATIDLNSVLEREFSV   1611 - 1680
QSLTSVVSEECFYETESHGKS                                                    1681 - 1701
//

Text Mined References (16)

PMID Year Title
24377522 2013 TIAM2 enhances non-small cell lung cancer cell invasion and motility.
21469146 2012 Expression of T-cell lymphoma invasion and metastasis 2 (TIAM2) promotes proliferation and invasion of liver cancer.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
11900975 2002 Expression of stef, an activator of Rac1, correlates with the stages of neuronal morphological development in the mouse brain.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
10512681 1999 Cloning and characterization of T-cell lymphoma invasion and metastasis 2 (TIAM2), a novel guanine nucleotide exchange factor related to TIAM1.
10364228 1999 Identification of the stef gene that encodes a novel guanine nucleotide exchange factor specific for Rac1.