Property Summary

NCBI Gene PubMed Count 124
PubMed Score 174.67
PubTator Score 169.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
nephrosclerosis 1.248 1.0e-03
malignant mesothelioma 5.200 2.8e-08
esophageal adenocarcinoma -2.700 2.7e-02
psoriasis -3.900 7.1e-05
ependymoma -1.300 3.8e-05
glioblastoma -1.300 3.9e-04
group 3 medulloblastoma -1.900 8.9e-03
cystic fibrosis -1.016 1.1e-04
atypical teratoid / rhabdoid tumor -1.900 1.4e-03
medulloblastoma, large-cell -3.000 7.1e-05
primitive neuroectodermal tumor -1.500 7.1e-03
Common variable immunodeficiency -1.029 1.4e-02
intraductal papillary-mucinous adenoma (... -1.400 3.9e-02
lung cancer -1.600 9.0e-05
interstitial cystitis -1.200 3.7e-03
adult high grade glioma -1.600 4.2e-03
primary Sjogren syndrome 1.200 1.1e-02
subependymal giant cell astrocytoma -3.354 1.5e-02
ductal carcinoma in situ 1.100 5.7e-03
ovarian cancer -2.800 1.7e-08
pituitary cancer -2.300 3.7e-04

Gene RIF (89)

PMID Text
26884821 Tiam1 expression significantly increased in cholangiocarcinoma tissues, and increased along with the degree of malignancy of cholangiocarcinoma. Targeted silencing Tiam1 expression could inhibit proliferation and migration activity of cholangiocarcinoma cells.
26821678 fibroblast expression patterns of Tiam1 and osteopontin in human breast cancers show converse changes correlating with invasion, supporting the hypothesis that this pathway in tumor-associated fibroblasts regulates breast cancer invasiveness
26575881 The polymorphisms rs2833188 and rs2833195 in TIAM1 gene may be associated with some clinical characteristics in children with Kawasaki disease.
25973950 The downregulation of MiR-182 is associated with the growth and invasion of osteosarcoma cells through the regulation of TIAM1 expression.
25746002 Study identifies a bidirectional (phosphorylation and dephosphorylation) regulatory mechanism controlling Tiam1 stability and provides new insights on how EGFR signaling triggers Rac1 activation and cancer development.
25684205 Heterodimeric CUL3 proteinubiquitylates TIAM1.CUL3 regulates TIAM1 abundance and subsequent RAC1 signaling.
25672412 These results suggested that Tiam1 overexpression in LSCC is possibly involved in the promotion of migration and invasion, and is a promising therapeutic target in the prevention of the progression of LSCC.
25654811 We identified T lymphoma invasion and metastasis 1 (TIAM1) gene as potential target of miR-329 in gastric cancer
25543140 we show that HUWE1 stimulates human lung cancer cell invasion through regulating TIAM1 stability. Finally, we demonstrate that HUWE1 and TIAM1 protein levels are inversely correlated in human lung carcinomas
25124033 Degradation of Tiam1 by casein kinase 1 and the SCFbetaTrCP ubiquitin ligase controls the duration of mTOR-S6K signaling.
25101856 These data demonstrate, that in addition to microtubule-independent Tiam1 activation, HGF engages additional microtubule- and APC-dependent pathway of Asef activation.
25032858 MiR-29b suppresses tumor growth and metastasis in colorectal cancer via downregulating Tiam1 expression.
24912585 Data support the notion that Tiam1 plays an important role in the progression of nasopharyngeal carcinoma (NPC), and its overexpression is associated with malignant phenotypes of NPC.
24905281 TIAM1 is activated by phosphatidylinositol 5-phosphate which activates RAC1, regulating actin dynamics and cell invasion.
24737324 Our results uncover that inhibition of proteasome-mediated Tiam1 degradation is an upstream event leading to Rac1/JNK activation and cell apoptosis in response to DNA-damaging drug treatment.
24661909 Tiam1 expression may be beneficial in predicting lymph node metastasis and survival of patients with lung adenocarcinoma
24554007 TIAM1-RAC1-NOX2 signalling axis is activated in the initial stages of diabetes to increase intracellular ROS leading to mitochondrial damage and accelerated capillary cell apoptosis
24551096 miR-141 functions as a tumor suppressor and inhibits the migration and invasion of hepatocellular carcinoma cells by targeting Tiam1.
24501217 Tiam1 contribute to chronic lymphocytic leukemia cells proliferation and chemoresistance.
24493373 The rs13048019 in the TIMA1 gene are unlikely to be common cause of SALS in Chinese population
24362520 Authors propose a model for Rac1 activation where SIRT1/2 positively modulates the DVL/TIAM1/Rac1 axis and promotes sustained pathway activation.
24350867 The 5-LOX/LTC4 /CysLT1 signaling pathway regulates EGF-induced cell migration by increasing Tiam1 expression.
24189000 Data show that T-lymphoma invasion and metastasis inducing factor 1 (Tiam1) may contribute to squamous-cell carcinoma of the head and neck (SCCH) progression, and represent as a prognostic indicator as well as a potential therapeutic target for SCCHN.
24112471 Tiam1 associates with EphA2 receptors in early endosomes and is required for endocytic trafficking of EphA2 receptors.
24046447 nitric oxide is a key molecule promoting endothelial cell permeability, linking the cytoskeleton to VE-cadherin phosphorylation through regulation of the endothelial-junction-associated Rac guanine-nucleotide-exchange factor (GEF) TIAM1.
23950931 Data show that T lymphoma invasion and metastasis protein (Tiam1) modulates the cell invasion, mediated by actin cytoskeleton remodeling in retinoblastoma (RB).
23757206 Due to their specificity over related GEF proteins they may represent promising tools for further elucidation of the biological functions of Tiam1.
23754572 Downregulation of Tcell lymphoma invasion and metastasisinducing factor 1 induces cytoskeletal rearrangement and inhibits the invasive capacity of gastric cancer cells.
23534724 Over-expression of Tiam-1 contributes to the invasive phenotype of gastric cancer cells.
23440286 MiR-22 expression inhibited TIAM1 mRNA and protein expression.
23422181 In gastric cancer cells, Tiam1 affects multiple properties associated with acquisition of the metastatic phenotype, and may be a marker of gastric cancer progression and metastasis in a subset of cancer.
23322732 these results suggest that the progression of pancreatic tumors is partially controlled by the balance between Tiam1-rac1 and RhoA.
23307871 PGD(2)-DP signaling reduces vascular permeability via endothelial cAMP/PKA/Tiam1/Rac1 pathway.
23291131 Tiam1 is closely related with invasion and metastasis of breast carcinoma.
23142282 The miR-29c/TIAM1 pathway further elucidates the molecular mechanisms regulating invasion and metastasis in nasopharyngeal carcinoma.
23071154 Tiam1, with the PAR complex, binds to integrins through talin and, together with the PAR complex, thereby regulates Rac1 activity and adhesion turnover for polarized migration.
22573407 Results indicate that Tiam1, as a metastasis-related gene, may contribute to HCC invasion and metastasis.
22524833 High Tiam1 protein expression is associated with lung cancer development and metastasis.
22469921 Tiam1 may be involved in the aggressive behavior of ovarian cancer, and differential expression of microRNA may contribute to the dysregulation of Tiam1, which contributes to the invasive, migratory and viability properties of ovarian cancer cells
22027789 Tiam1 is an invasion and metastasis inducing factor of lung carcinoma. The overexpression of Tiam1 is closely associated with lymph node metastases, TNM stage and histological types of lung carcinoma.
21876037 activation through the T cell receptor results in phosphorylation of LFA-1 that leads to engagement of Tiam1 and Rac1
21853342 Tiam1 and Rac1 expressions may be independent predictors for the poor prognosis in patients with primary gallbladder carcinoma
21302295 These findings suggest a previously unrecognized mechanism of integrin-induced Rac1 activation in which 14-3-3 dimers localize Tiam1 to integrin complexes, where it mediates integrin-dependent Rac1 activation, thus initiating motility-inducing pathways.
21237486 promotor hypomethylation of T-lymphoma invasion and metastasis 1 may play a role in the progression and metastasis of colorectal cancer
21186404 Tiam1 may be used as molecular marker for predicting the prognosis of patients with esophageal squamous cell carcinoma.
20826792 Data show that TIAM1, a guanidine exchange factor of the Rac GTPase, is a direct target of both miR-21 and miR-31.
20819206 Tiam1 expression correlates with cell motility in breast cancer cells and is required to support the motile phenotype; localization of endogenous Tiam1 to the Golgi, and its role in Golgi reorientation, suggest it may support motility through a mechanism discrete from its known function in leading edge dynamics
20802514 Stromal Tiam1 has a role in modulating the effects of the tumor microenvironment on malignant cell invasion and metastasis.
20522449 Increased TIAM1 is associated with vascular invasion and intrahepatic metastasis hepatocellular carcinoma.
20496116 regulates EphA8-ephrinA5 signaling and clathrin-mediated endocytosis
20444703 Mechanism for the regulation of Tiam1-mediated Rac protein activation in breast cancer.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20361982 Cell biological analysis established that Syndecan1 is a physiological binding partner of Tiam1 and that the PDZ domain has a function in cell-matrix adhesion and cell migration.
20360004 IRSp53 and spinophilin regulate localized Rac activation by T-lymphocyte invasion and metastasis protein 1
20215110 results indicate that Tiam1 integrates signals from CADM1 to regulate the actin cytoskeleton through Rac activation, which may lead to tissue infiltration of leukemic cells in ATL patients
20018857 Expression of constitutively active PI3K stimulated translocation of Tiam1 to the membrane, increased Rac1 activity, and increased wound healing of airway epithelial cells.
19923095 The expression of Tiam1 was significantly higher in breast carcinomas than in normal breast tissue, and was correlated to node metastasis and clinical stage.
19911011 Observational study of gene-disease association. (HuGE Navigator)
19575901 Tiam1 expression correlates with the invasion and metastasis of nasopharyngeal carcinoma cells.
19506399 Upregulation of Tiam1 and Rac1 proteins may play a critical role in tumor progression of nasopharyngeal carcinoma
19285946 SRC-induced disassembly of adherens junctions requires localized phosphorylation and degradation of the rac activator tiam1.
19276682 Overexpression of Tiam1 is associated with lymphangiogenesis in colorectal carcinoma.
19246286 Tiam1 is related to the metastasis of colorectal carcinoma, and may induce epithelial-mesenchymal transition to promote metastasis.
19218104 Tiam-1 expression is closely associated with the invasiveness and metastasis of nasopharyngeal carcinoma.
19095647 PAF-induced IEJ disruption and increased endothelial permeability requires the activation of a Tiam1-Rac1 signaling module, suggesting a novel therapeutic target against increased vascular permeability associated with inflammatory diseases.
19082465 Tiam1 counteracts the progression of breast carcinomas and is suitable as a novel breast tumor marker.
18972435 Tiam1 expression may be a novel and independent predictor for the prognosis of hepatocellular carcinoma
18826597 results suggest that Rac1 and the Rac1-specific activator Tiam1 are components of transcriptionally active beta-catenin/TCF complexes at Wnt-responsive promoters, and Rac1 and Tiam1 within these complexes serves to enhance target gene transcription
18805958 Tiam1, a Rac1-specific guanine nucleotide exchange factor, was expressed mainly in the cytosol of AT2 cells exposed to mechanical strain compared with membrane localization in static cells.
18675922 Results identify three genes, high-mobility group box1, annexin IV and phosphoglycerate mutase 1 that were associated with Tiam1 and may be involved in colorectal cancer metastasis.
18006851 16k PRL inhibits cell migration by blocking the Ras-Tiam1-Rac1-Pak1 signaling pathway in endothelial cells
17822624 Tiam1 gene plays an important role in the proliferation, invasion and metastasis of colorectal cancer.
17702746 CD44 is an important regulator of HGF/c-Met-mediated in vitro and in vivo barrier enhancement, a process with essential involvement of Tiam1, Rac1, dynamin 2, and cortactin.
17584632 Data show that Tiam-1 gene may play an important role in invasion and metastasis of colorectal cancer.
17376711 Tiam1 transfection in colorectal cancer cells could upregulate the expression of Fascin-1, heat shock protein 27 (HSP27), high-mobility group box 1 (HMGB1), glutathione S-transferase omega 1 (GSTO1) and downregulate the expression of annexin IV.
17219408 Tiam1 and betaPIX mediate OxPAPC-induced Rac activation, cytoskeletal remodeling, and barrier protective response in pulmonary endothelium
17132223 Tiam1 plays a causal role in the metastasis of colorectal cancer
17086355 Tiam1 is overexpressed in a subset of human colorectal tumors. It affects multiple properties associated with acquisition of the metastatic phenotype & may represent a marker of colon tumor progression & metastasis in a subset of tumors.
17003780 Data suggest that strong Tiam1 overexpression relative to the corresponding benign epithelial cells is a new and independent predictor of decreased disease-free survival for patients with prostate cancer.
16334253 Overexpression of the Tiam1 gene correlates with invasion and metastasis of nasopharyngeal carcinoma.
16195373 S1P-induced recruitment of S1P1 to CEM fractions promotes PI3 kinase-mediated Tiam1/Rac1 activation required for alpha-actinin-1/4-regulated cortical actin rearrangement and EC barrier enhancement
15899863 Tiam1 activates Rac and contributes to Rac signaling specificity through binding to IRSp53.
15655826 Tiam1 gene may play an important role in invasion and metastasis of colorectal carcinoma and is a metastasis-related gene.
15479739 Rap1 promotes cell spreading by localizing a subset of Rac GEFs to sites of active lamellipodia extension
15340013 Results suggest a role for Tiam1/Rac signaling in the control of cell-cell contacts through a novel ALCAM-mediated mechanism.
15295645 expression level of Tiam1 in two giant-cell lung carcinoma cell strains with high or low metastasis potential
15242348 Distinct phosphoinositides regulate different functions of Tiam1.
12810717 Vav2 and Tiam1 may act as downstream effectors of Src, thereby regulating Rac1-dependent pathways that participate in Src-induced cell transformation
12446731 Tiam1 is c-Myc regulator, working in the nuclei to control c-Myc-related apoptosis

AA Sequence

MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSSTPSIPQSLAE      1 - 70
NGLEPFSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTAASVQSMPDTEESRLYGDDAT     71 - 140
YLAEGGRRQHSYTSNGPTFMETASFKKKRSKSADIWREDSLEFSLSDLSQEHLTSNEEILGSAEEKDCEE    141 - 210
ARGMETRASPRQLSTCQRANSLGDLYAQKNSGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEET    211 - 280
PPYSNYNTLPCRKSHCLSEGATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRS    281 - 350
NATNSSYSPTTGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP    351 - 420
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESDGRSGIDHNSI    421 - 490
PKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITAIHSACATAVARHHHKEDTL    491 - 560
RLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTILDQIFVWEQNLEQFQMDLFRFRCYLASLQG    561 - 630
GELPNPKRLLAFASRPTKVAMGRLGIFSVSSFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLD    631 - 700
TTSKKKQGRPSINQVFGEGTEAVKKSLEGIFDDIVPDGKREKEVVLPNVHQHNPDCDIWVHEYFTPSWFC    701 - 770
LPNNQPALTVVRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQLYVPQPEEDIYELLYKEIEICP    771 - 840
KVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSM    841 - 910
LKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTSNPGHSLCSEQGSSAETAPEE    911 - 980
TEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPSPQDSTGPQLATMRQLSDADKLRKVICELLE    981 - 1050
TERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQ   1051 - 1120
FKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPI   1121 - 1190
QRILKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA   1191 - 1260
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSIYEDWDPFR   1261 - 1330
FRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSPESRKDFLKAVHSILRDKHRR   1331 - 1400
QLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPSKSLGRRRRRLARNRFTIDSDAVSASSPEKE   1401 - 1470
SQQPPGGGDTDRWVEEQFDLAQYEEQDDIKETDILSDDDEFCESVKGASVDRDLQERLQATSISQRERGR   1471 - 1540
KTLDSHASRMAQLKKQAALSGINGGLESASEEVIWVRREDFAPSRKLNTEI                      1541 - 1591
//

Text Mined References (133)

PMID Year Title
26884821 2015 Biological effects of RNAi targeted inhibiting Tiam1 gene expression on cholangiocarcinoma cells.
26821678 2016 The fibroblast Tiam1-osteopontin pathway modulates breast cancer invasion and metastasis.
26575881 2015 [Association of TIAM1 gene polymorphisms with Kawasaki disease and its clinical characteristics].
25973950 2015 The Downregulation of MiR-182 Is Associated with the Growth and Invasion of Osteosarcoma Cells through the Regulation of TIAM1 Expression.
25746002 2015 An EGFR/PI3K/AKT axis promotes accumulation of the Rac1-GEF Tiam1 that is critical in EGFR-driven tumorigenesis.
25684205 2015 CUL3-KBTBD6/KBTBD7 ubiquitin ligase cooperates with GABARAP proteins to spatially restrict TIAM1-RAC1 signaling.
25672412 2015 Overexpression of Tiam1 promotes the progression of laryngeal squamous cell carcinoma.
25654811 2015 By downregulating TIAM1 expression, microRNA-329 suppresses gastric cancer invasion and growth.
25543140 2015 HUWE1 ubiquitylates and degrades the RAC activator TIAM1 promoting cell-cell adhesion disassembly, migration, and invasion.
25124033 2014 Degradation of Tiam1 by casein kinase 1 and the SCF?TrCP ubiquitin ligase controls the duration of mTOR-S6K signaling.
25101856 2014 Hepatocyte growth factor triggers distinct mechanisms of Asef and Tiam1 activation to induce endothelial barrier enhancement.
25032858 2014 miR-29b suppresses tumor growth and metastasis in colorectal cancer via downregulating Tiam1 expression and inhibiting epithelial-mesenchymal transition.
24912585 2014 Overexpression of Tiam1 is associated with malignant phenotypes of nasopharyngeal carcinoma.
24905281 2014 Phosphatidylinositol 5-phosphate regulates invasion through binding and activation of Tiam1.
24737324 2014 DNA damage induces the accumulation of Tiam1 by blocking ?-TrCP-dependent degradation.
24661909 2014 Expression of Tiam1 predicts lymph node metastasis and poor survival of lung adenocarcinoma patients.
24554007 2014 TIAM1-RAC1 signalling axis-mediated activation of NADPH oxidase-2 initiates mitochondrial damage in the development of diabetic retinopathy.
24551096 2014 MiR-141 suppresses the migration and invasion of HCC cells by targeting Tiam1.
24501217 2014 Tiam1/Rac1 signals contribute to the proliferation and chemoresistance, but not motility, of chronic lymphocytic leukemia cells.
24493373 2014 Association analysis of four candidate genetic variants with sporadic amyotrophic lateral sclerosis in a Chinese population.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24362520 2015 The sirtuins promote Dishevelled-1 scaffolding of TIAM1, Rac activation and cell migration.
24350867 2014 5-Lipoxygenase and cysteinyl leukotriene receptor 1 regulate epidermal growth factor-induced cell migration through Tiam1 upregulation and Rac1 activation.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
24189000 2014 Elevated expression of T-lymphoma invasion and metastasis inducing factor 1 in squamous-cell carcinoma of the head and neck and its clinical significance.
24112471 2013 EphA2 signaling following endocytosis: role of Tiam1.
24046447 2013 eNOS-derived nitric oxide regulates endothelial barrier function through VE-cadherin and Rho GTPases.
23950931 2013 RNAi mediated Tiam1 gene knockdown inhibits invasion of retinoblastoma.
23832200 2013 High-resolution structure of the Tiam1 PHn-CC-Ex domain.
23757206 2013 RNA-aptamers that modulate the RhoGEF activity of Tiam1.
23754572 2013 Downregulation of T?cell lymphoma invasion and metastasis?inducing factor 1 induces cytoskeletal rearrangement and inhibits the invasive capacity of gastric cancer cells.
23534724 2013 Effects of Tiam 1 on invasive capacity of gastric cancer cells in vitro and underlying mechanisms.
23440286 2013 miRNA-22 suppresses colon cancer cell migration and invasion by inhibiting the expression of T-cell lymphoma invasion and metastasis 1 and matrix metalloproteinases 2 and 9.
23422181 2013 Up-regulation of T-lymphoma and metastasis gene 1 in gastric cancer and its involvement in cell invasion and migration.
23395182 2013 The structure of the Tiam1 PDZ domain/ phospho-syndecan1 complex reveals a ligand conformation that modulates protein dynamics.
23322732 2013 Balanced Tiam1-rac1 and RhoA drives proliferation and invasion of pancreatic cancer cells.
23307871 2013 Prostaglandin D2-DP signaling promotes endothelial barrier function via the cAMP/PKA/Tiam1/Rac1 pathway.
23291131 2012 [Effects of Tiam1 on invasion and metastasis of breast carcinoma and its mechanisms].
23142282 2013 MiR-29c suppresses invasion and metastasis by targeting TIAM1 in nasopharyngeal carcinoma.
23109420 2013 Tiam1 regulates the Wnt/Dvl/Rac1 signaling pathway and the differentiation of midbrain dopaminergic neurons.
23071154 2012 Tiam1 interaction with the PAR complex promotes talin-mediated Rac1 activation during polarized cell migration.
22573407 2013 Tiam1 is associated with hepatocellular carcinoma metastasis.
22524833 2012 Expression of Tiam1 in lung cancer and its clinical significance.
22469921 2012 Tiam1, negatively regulated by miR-22, miR-183 and miR-31, is involved in migration, invasion and viability of ovarian cancer cells.
22100072 2011 Recessive mutations in ELOVL4 cause ichthyosis, intellectual disability, and spastic quadriplegia.
22044751 2011 Heritability and genome-wide association analysis of renal sinus fat accumulation in the Framingham Heart Study.
22027789 2011 [Quantitative analysis of Tiam1 expression in lung cancer and its clinical significance].
21876037 2011 TCR-induced activation of LFA-1 involves signaling through Tiam1.
21853342 2012 Clinical value of Tiam1-Rac1 signaling in primary gallbladder carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21302295 2011 Tiam1 is recruited to ?1-integrin complexes by 14-3-3? where it mediates integrin-induced Rac1 activation and motility.
21237486 2011 Methylation status of T-lymphoma invasion and metastasis 1 promoter and its overexpression in colorectal cancer.
21186404 2011 Overexpression of Tiam1 predicts poor prognosis in patients with esophageal squamous cell carcinoma.
20826792 2010 miR-21 and miR-31 converge on TIAM1 to regulate migration and invasion of colon carcinoma cells.
20819206 2010 Regulation of breast cancer cell motility by T-cell lymphoma invasion and metastasis-inducing protein.
20802514 2010 The role of fibroblast Tiam1 in tumor cell invasion and metastasis.
20801718 2010 Chromosome 9p21 in amyotrophic lateral sclerosis in Finland: a genome-wide association study.
20522449 2010 Up-regulation of Tiam1 and Rac1 correlates with poor prognosis in hepatocellular carcinoma.
20496116 2010 EphA8-ephrinA5 signaling and clathrin-mediated endocytosis is regulated by Tiam-1, a Rac-specific guanine nucleotide exchange factor.
20444703 2010 miR-10b targets Tiam1: implications for Rac activation and carcinoma migration.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20361982 2010 The Tiam1 PDZ domain couples to Syndecan1 and promotes cell-matrix adhesion.
20360004 2010 Scaffold proteins IRSp53 and spinophilin regulate localized Rac activation by T-lymphocyte invasion and metastasis protein 1 (TIAM1).
20332120 2010 CCM1 regulates vascular-lumen organization by inducing endothelial polarity.
20215110 2010 CADM1 interacts with Tiam1 and promotes invasive phenotype of human T-cell leukemia virus type I-transformed cells and adult T-cell leukemia cells.
20018857 2010 Cyclic mechanical stretch decreases cell migration by inhibiting phosphatidylinositol 3-kinase- and focal adhesion kinase-mediated JNK1 activation.
19923095 2009 [Expression of Tiam1 in breast carcinomas and its clinical significance].
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19575901 2009 [Overexpression of Tiam1 gene and its relationship with invasive and metastatic ability of nasopharyngeal carcinoma].
19506399 2009 Prognostic value of Tiam1 and Rac1 overexpression in nasopharyngeal carcinoma.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19285946 2009 SRC-induced disassembly of adherens junctions requires localized phosphorylation and degradation of the rac activator tiam1.
19276682 2009 Expression of Tiam1 and VEGF-C correlates with lymphangiogenesis in human colorectal carcinoma.
19246286 2009 [Correlation between T lymphoma invasion and metastasis 1 expression and epithelial-mesenchymal transition in human colorectal carcinomas].
19218104 2009 [Relationship between Tiam-1 expression and the biological behaviors of nasopharyngeal carcinoma].
19095647 2009 Tiam1 and Rac1 are required for platelet-activating factor-induced endothelial junctional disassembly and increase in vascular permeability.
19082465 2009 Progression of breast tumors is accompanied by a decrease in expression of the Rho guanine exchange factor Tiam1.
18972435 2009 Overexpression of Tiam1 in hepatocellular carcinomas predicts poor prognosis of HCC patients.
18826597 2008 Rac1 GTPase and the Rac1 exchange factor Tiam1 associate with Wnt-responsive promoters to enhance beta-catenin/TCF-dependent transcription in colorectal cancer cells.
18805958 2008 Mechanical stretch decreases migration of alveolar epithelial cells through mechanisms involving Rac1 and Tiam1.
18675922 2008 Identification of potential genes/proteins regulated by Tiam1 in colorectal cancer by microarray analysis and proteome analysis.
18006851 2007 16-kDa prolactin inhibits endothelial cell migration by down-regulating the Ras-Tiam1-Rac1-Pak1 signaling pathway.
17822624 2007 [Effect of Tiam1 overexpression on proliferation and metastatic potential of human colorectal cancer].
17702746 2007 CD44 regulates hepatocyte growth factor-mediated vascular integrity. Role of c-Met, Tiam1/Rac1, dynamin 2, and cortactin.
17584632 2007 [Effect of Tiam-l gene silencing on human colorectal carcinoma cell line SW480 metastasis in nude mice observed by real-time whole-body fluorescence imaging].
17376711 2007 Proteomic analysis of Tiam1-mediated metastasis in colorectal cancer.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17219408 2007 Tiam1 and betaPIX mediate Rac-dependent endothelial barrier protective response to oxidized phospholipids.
17132223 2006 Lentivirus-mediated silencing of Tiam1 gene influences multiple functions of a human colorectal cancer cell line.
17086355 2006 Tiam1 regulates cell adhesion, migration and apoptosis in colon tumor cells.
17003780 2006 Prognostic relevance of Tiam1 protein expression in prostate carcinomas.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16334253 2005 [Correlation between expression of the Tiam1 gene and the invasion and metastasis in nasopharyngeal carcinoma].
16195373 2005 Regulation of sphingosine 1-phosphate-induced endothelial cytoskeletal rearrangement and barrier enhancement by S1P1 receptor, PI3 kinase, Tiam1/Rac1, and alpha-actinin.
16192287 2005 No widespread induction of cell death genes occurs in pure motoneurons in an amyotrophic lateral sclerosis mouse model.
15899863 2005 Tiam1-IRSp53 complex formation directs specificity of rac-mediated actin cytoskeleton regulation.
15723052 2005 Par-3 controls tight junction assembly through the Rac exchange factor Tiam1.
15721239 2005 The Rac1-GEF Tiam1 couples the NMDA receptor to the activity-dependent development of dendritic arbors and spines.
15655826 2005 Tiam1 gene expression and its significance in colorectal carcinoma.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15479739 2004 Rap1 promotes cell spreading by localizing Rac guanine nucleotide exchange factors.
15340013 2004 The RacGEF Tiam1 inhibits migration and invasion of metastatic melanoma via a novel adhesive mechanism.
15324660 2004 Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization.
15295645 2004 Antisense Tiam1 down-regulates the invasiveness of 95D cells in vitro.
15242348 2004 Inositol phospholipids regulate the guanine-nucleotide-exchange factor Tiam1 by facilitating its binding to the plasma membrane and regulating GDP/GTP exchange on Rac1.
14988728 2004 Tiam1 mediates neurite outgrowth induced by ephrin-B1 and EphA2.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12810717 2003 Rac1 function is required for Src-induced transformation. Evidence of a role for Tiam1 and Vav2 in Rac activation by Src.
12787561 Ten years on: mediation of cell death by the common neurotrophin receptor p75(NTR).
12531897 2003 Regulation of p70 S6 kinase by complex formation between the Rac guanine nucleotide exchange factor (Rac-GEF) Tiam1 and the scaffold spinophilin.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446731 2003 Guanine nucleotide exchange factor, Tiam1, directly binds to c-Myc and interferes with c-Myc-mediated apoptosis in rat-1 fibroblasts.
12376551 2002 RhoG signals in parallel with Rac1 and Cdc42.
12376548 2002 NRAGE, a p75 neurotrophin receptor-interacting protein, induces caspase activation and cell death through a JNK-dependent mitochondrial pathway.
12134164 2002 Tiam1 mediates Ras activation of Rac by a PI(3)K-independent mechanism.
12024021 2002 Interaction of Rac exchange factors Tiam1 and Ras-GRF1 with a scaffold for the p38 mitogen-activated protein kinase cascade.
11756498 2002 Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.
11595749 2001 Trp(56) of rac1 specifies interaction with a subset of guanine nucleotide exchange factors.
11274357 2001 Tumor metastasis suppressor nm23H1 regulates Rac1 GTPase by interaction with Tiam1.
11130063 2000 Crystal structure of Rac1 in complex with the guanine nucleotide exchange region of Tiam1.
10893266 2000 Ankyrin-Tiam1 interaction promotes Rac1 signaling and metastatic breast tumor cell invasion and migration.
10835422 2000 Regulation of Tiam1 nucleotide exchange activity by pleckstrin domain binding ligands.
10830953 2000 The DNA sequence of human chromosome 21.
10636882 2000 CD44 interaction with tiam1 promotes Rac1 signaling and hyaluronic acid-mediated breast tumor cell migration.
10212259 1999 Ca2+/calmodulin-dependent protein kinase II regulates Tiam1 by reversible protein phosphorylation.
9128250 1997 Regulated membrane localization of Tiam1, mediated by the NH2-terminal pleckstrin homology domain, is required for Rac-dependent membrane ruffling and C-Jun NH2-terminal kinase activation.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8595894 1995 Localization of a human homolog of the mouse Tiam-1 gene to chromosome 21q22.1.
7753201 1995 A role for Rac in Tiam1-induced membrane ruffling and invasion.
7736788 1995 The invasion-inducing TIAM1 gene maps to human chromosome band 21q22 and mouse chromosome 16.
7731688 1995 Sequence of the human invasion-inducing TIAM1 gene, its conservation in evolution and its expression in tumor cell lines of different tissue origin.