Property Summary

NCBI Gene PubMed Count 135
PubMed Score 186.36
PubTator Score 169.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
adult high grade glioma -1.600 4.2e-03
atypical teratoid / rhabdoid tumor -1.900 1.4e-03
Common variable immunodeficiency -1.029 1.4e-02
cystic fibrosis -1.016 1.1e-04
ductal carcinoma in situ 1.100 5.7e-03
ependymoma -1.300 3.8e-05
esophageal adenocarcinoma -2.700 2.7e-02
glioblastoma -1.300 3.9e-04
group 3 medulloblastoma -1.900 8.9e-03
interstitial cystitis -1.200 3.7e-03
intraductal papillary-mucinous adenoma (... -1.400 3.9e-02
lung cancer -1.600 9.0e-05
malignant mesothelioma 3.000 3.9e-07
medulloblastoma, large-cell -3.000 7.1e-05
nephrosclerosis 1.248 1.0e-03
ovarian cancer -2.800 1.7e-08
pituitary cancer -2.300 3.7e-04
primary Sjogren syndrome 1.200 1.1e-02
primitive neuroectodermal tumor -1.500 7.1e-03
psoriasis 1.100 2.3e-08
subependymal giant cell astrocytoma -2.444 3.7e-03

 IMPC Phenotype (1)

PDB (10)

Gene RIF (98)

AA Sequence

MGNAESQHVEHEFYGEKHASLGRKHTSRSLRLSHKTRRTRHASSGKVIHRNSEVSTRSSSTPSIPQSLAE      1 - 70
NGLEPFSQDGTLEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTAASVQSMPDTEESRLYGDDAT     71 - 140
YLAEGGRRQHSYTSNGPTFMETASFKKKRSKSADIWREDSLEFSLSDLSQEHLTSNEEILGSAEEKDCEE    141 - 210
ARGMETRASPRQLSTCQRANSLGDLYAQKNSGVTANGGPGSKFAGYCRNLVSDIPNLANHKMPPAAAEET    211 - 280
PPYSNYNTLPCRKSHCLSEGATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGATTDTDLLSRRS    281 - 350
NATNSSYSPTTGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP    351 - 420
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESDGRSGIDHNSI    421 - 490
PKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWITAIHSACATAVARHHHKEDTL    491 - 560
RLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTILDQIFVWEQNLEQFQMDLFRFRCYLASLQG    561 - 630
GELPNPKRLLAFASRPTKVAMGRLGIFSVSSFHALVAARTGETGVRRRTQAMSRSASKRRSRFSSLWGLD    631 - 700
TTSKKKQGRPSINQVFGEGTEAVKKSLEGIFDDIVPDGKREKEVVLPNVHQHNPDCDIWVHEYFTPSWFC    701 - 770
LPNNQPALTVVRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQLYVPQPEEDIYELLYKEIEICP    771 - 840
KVTQSIHIEKSDTAADTYGFSLSSVEEDGIRRLYVNSVKETGLASKKGLKAGDEILEINNRAADALNSSM    841 - 910
LKDFLSQPSLGLLVRTYPELEEGVELLESPPHRVDGPADLGESPLAFLTSNPGHSLCSEQGSSAETAPEE    911 - 980
TEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDQSPSPQDSTGPQLATMRQLSDADKLRKVICELLE    981 - 1050
TERTYVKDLNCLMERYLKPLQKETFLTQDELDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQ   1051 - 1120
FKKVLFSLGGSFLYYADRFKLYSAFCASHTKVPKVLVKAKTDTAFKAFLDAQNPKQQHSSTLESYLIKPI   1121 - 1190
QRILKYPLLLRELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA   1191 - 1260
DLSMGDLLLHTTVIWLNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRLSIYEDWDPFR   1261 - 1330
FRHMIPTEALQVRALASADAEANAVCEIVHVKSESEGRPERVFHLCCSSPESRKDFLKAVHSILRDKHRR   1331 - 1400
QLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPSKSLGRRRRRLARNRFTIDSDAVSASSPEKE   1401 - 1470
SQQPPGGGDTDRWVEEQFDLAQYEEQDDIKETDILSDDDEFCESVKGASVDRDLQERLQATSISQRERGR   1471 - 1540
KTLDSHASRMAQLKKQAALSGINGGLESASEEVIWVRREDFAPSRKLNTEI                      1541 - 1591
//

Text Mined References (143)

PMID Year Title