Property Summary

NCBI Gene PubMed Count 49
PubMed Score 89.32
PubTator Score 65.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Liver Cirrhosis, Experimental 769 0.0 0.0
Disease Target Count P-value
ovarian cancer 8520 2.1e-09
glioblastoma 5792 2.6e-04
invasive ductal carcinoma 2951 3.3e-04
adult high grade glioma 3801 1.0e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
relapsing-remitting multiple sclerosis 18 3.828 1.9

Expression

  Differential Expression (4)

Disease log2 FC p
adult high grade glioma -1.200 1.0e-03
glioblastoma -1.200 2.6e-04
invasive ductal carcinoma -1.200 3.3e-04
ovarian cancer -1.900 2.1e-09

Protein-protein Interaction (3)

Gene RIF (30)

AA Sequence

MMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNG      1 - 70
RKILGKEVKVNWATTPSSQKKDTSNHFHVFVGDLSPEITTEDIKSAFAPFGKISDARVVKDMATGKSKGY     71 - 140
GFVSFYNKLDAENAIVHMGGQWLGGRQIRTNWATRKPPAPKSTQENNTKQLRFEDVVNQSSPKNCTVYCG    141 - 210
GIASGLTDQLMRQTFSPFGQIMEIRVFPEKGYSFVRFSTHESAAHAIVSVNGTTIEGHVVKCYWGKESPD    211 - 280
MTKNFQQVDYSQWGQWSQVYGNPQQYGQYMANGWQVPPYGVYGQPWNQQGFGVDQSPSAAWMGGFGAQPP    281 - 350
QGQAPPPVIPPPNQAGYGMASYQTQ                                                 351 - 375
//

Text Mined References (54)

PMID Year Title