Property Summary

NCBI Gene PubMed Count 167
PubMed Score 1666.50
PubTator Score 998.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count
Reperfusion Injury 84
Retinal Diseases 21

Expression

  Differential Expression (33)

Disease log2 FC p
interstitial lung disease 2.800 4.4e-03
urothelial carcinoma 1.300 5.0e-04
malignant mesothelioma -5.800 1.8e-09
astrocytic glioma -1.700 2.7e-03
posterior fossa group B ependymoma -3.300 1.3e-12
esophageal adenocarcinoma 1.100 2.8e-02
cutaneous lupus erythematosus 1.300 1.6e-03
glioblastoma -1.700 1.4e-03
oligodendroglioma -1.200 2.3e-09
osteosarcoma 2.172 1.5e-02
medulloblastoma -3.400 3.1e-09
atypical teratoid / rhabdoid tumor -3.200 3.4e-07
medulloblastoma, large-cell -3.000 4.1e-05
primitive neuroectodermal tumor -2.400 2.6e-03
Duchenne muscular dystrophy 1.135 1.1e-10
Becker muscular dystrophy 1.161 1.8e-04
adrenocortical carcinoma 1.058 9.2e-03
primary pancreatic ductal adenocarcinoma 3.187 1.4e-04
non-small cell lung cancer 1.378 3.2e-10
intraductal papillary-mucinous adenoma (... -2.300 6.7e-04
intraductal papillary-mucinous carcinoma... -2.200 2.4e-03
intraductal papillary-mucinous neoplasm ... -1.500 1.7e-02
Breast cancer 2.400 3.0e-02
interstitial cystitis 2.400 1.2e-04
lung adenocarcinoma 1.200 8.0e-09
adult high grade glioma -2.400 3.3e-05
Endometriosis 1.325 4.6e-02
Pick disease -1.600 2.1e-02
gastric carcinoma 3.200 9.8e-03
ulcerative colitis 1.600 3.3e-04
ovarian cancer 3.200 4.8e-06
Down syndrome -1.200 7.0e-04
pancreatic cancer 3.400 8.2e-05

Gene RIF (64)

PMID Text
26329007 CD90 is upregulated in gastric cancer and inhibits gastric cancer cell apoptosis by modulating the expression level of SPARC protein.
26272696 CD90+ liver cancer cells modulate endothelial cell phenotype through the release of exosomes containing H19 lncRNA.
26191205 CD105+/CD90+ subpopulation from breast cancer MDA-MB-231 cells possesses "mesenchymal stem cell-like" characteristics, and its high migratory ability might be associated with epithelial-mesenchymal transformation.
26147640 we found that THY-1 mediates human cytomegalovirus infection at the entry step and is important for infection
25672610 these data suggest that CD90+CXCR4+ HCC cells may be CTSCs and selective elimination of these cells may substantially improve the current hepatocellular carcinoma therapy by reducing cancer metastasis.
25536077 CD90 could serve as a promising marker for pancreatic adenocarcinoma.
25216363 Dynamic catch of a Thy-1-integrin alpha5beta1+syndecan-4 trimolecular complex explains extraordinary cancer cell adhesion to the vascular endothelium.
25168019 CD133, CD44, and CD90 could be used as prognostic and predictive markers in hepatoblastoma.
25070848 TLR4 activation enhances the PD-L1-mediated tolerogenic capacity of colonic CD90+ stromal cells.
25061736 Wnt/beta-catenin aids in regulating the proliferation of hepG2 cells mediated by thy-1.
25050599 We found that the vast majority of CD90(+) dermal cells are perivascularly located and generate a significantly higher percentage of regulatory T cells compared with cells expressing markers such as CD271 in vitro.
24751333 In the present study we analyzed the expression of four cell surface antigens relevant to human hematopoiesis-CD90, CD96, CD117, and CD123-in bone marrow from pediatric acute myeloid leukemia patients and normal control subjects.
24194916 THY1 may be a promising novel prognostic marker for male breast cancer.
24116172 Results indicate the importance of CD90 in the hepatocellular carcinoma (HCC).
24101104 These findings suggest that CD90 could be a potential marker of lung cancer stem cells and thus provide new insight into further therapeutic strategies of lung cancer.
24045552 CD90 is a diagnostic marker to differentiate between malignant pleural mesothelioma and lung carcinoma with immunohistochemistry.
23613866 These results indicate that suppression of the RhoA-mediated pathway might participate in the Thy-1-induced migration inhibition in human umbilical vein endothelial cells.
23438193 Positive correlation of Oct4 and ABCG2 to chemotherapeutic resistance in CD90(+)CD133(+) liver cancer stem cells.
23382045 High CD90 tumor-initiating cell population is associated with an aggressive signature and metastatic capacity in esophageal cancer.
23237599 We demonstrated that the expression of CSC marker CD90 is related to the expression of BORIS in hepatocellular carcinoma (HCC) tissue and HCC cell lines.
23159525 Thy-1 contributes to metastasis of melanoma cells by mechanisms involving a Thy-1-mediated adhesion of melanoma cells to endothelial cells.
22952721 an increased chondrogenic potential within the CD90+ fraction of human and canine synovial fluid mesenchymal progenitor cells
22807289 concentrations were increased in the sera of systemic sclerosis patients, particularly in those with vascular involvement of the lungs
22426060 The researchers demonstrate the role of CD90 as a marker of cancer stem cells within high-grade gliomas
22210915 binding of leukocytes to activated endothelium mediated by the interaction of CD97 with Thy-1 is involved in firm adhesion of polymorphonuclear cells during inflammation and may play a role in the regulation of leukocyte trafficking to inflammatory sites.
22203689 CD90 is not only a potential prognostic marker for high-grade gliomas but also a marker for cancer stem cells within gliomas
22184726 human CD90 identifies a subset of Th17 and Tc17 cells within CD4(+) and CD8(+) T cells, respectively, which are depleted during HIV infection
21743497 Data show that a cell population with the CD90 phenotype is enriched in sphere-cultured cells from gastric primary tumors.
21577212 Loss of Thy-1 in human lung fibroblasts induces a fibrogenic phenotype.
21272924 overexpression of Thy1 may not suppress the development of hepatocellular carcinoma(HCC) Thy1 could provide a clinical prognostic marker for HC
20562849 we have identified a stromal cell type (CD90+ fibroblasts) and a molecule (CD90) that distinguishes cancer-associated stroma from 'benign' stroma in the prostate
20478055 Observational study of gene-disease association. (HuGE Navigator)
20463011 Thy-1-integrin alpha(v)beta(5) interactions inhibit contraction-induced latent TGF-beta1 activation, presumably by blocking the binding of extracellular matrix-bound latent TGF-beta1 with integrin alpha(v)beta(5).
20043075 down-regulated KLF4, CHGA,GPX3, SST and LIPF, together with up-regulated SERPINH1, THY1 and INHBA is an 8-gene signature for gastric cancer
19921696 Loss of expression of THY1 is associated with nasopharyngeal carcinoma.
19737398 The CD90 positive prostate tumor-associated stromal cells showed decreased expression of CXC-chemokines and genes involved in smooth muscle differentiation.
19724880 Data identified three membrane-associated proteins, synaptosomal associated protein 25 (SNAP25), Thy-1 cell surface antigen and zonadhesin, interact with sex hormone binding globulin (SHBG)-ing proteins in the brain.
19615261 Down-regulated/loss expression of THY1 protein in epithelial ovarian cancer is significantly correlated with cancer cell proliferation and metastasis in the epithelial ovarian cancer.
19538887 The decreased level of THY1 expression may be related with the occurrence and development of ovarian serous cystadenocarcinoma.
19369333 HIV Gag proteins adopt a ring-like supramolecular organization at sites of intercellular contacts and co-localize with CD63 tetraspanin and raft components GM1, Thy-1, and CD59
19341705 CD90 and CD110 are are useful positive-selection markers for the isolation of cancer stem cells in some cases of T-ALL.
19324083 Mitogen-Activated Protein Kinases are essential signalling intermediates for the Antigen CD90 driven proliferation of mouse T-lymphocytes.
19267366 elevated expression of CD90 previously observed in the cancer-associated stroma of the human prostate is biologically significant
18976167 increased Thy-1 expression in Graves ophthalmopathy orbital tissues and cultures is likely a consequence of the orbital disease process, reflecting both the presence of increased numbers of Thy-1-positive cells and higher expression on those cells.
18556592 Epigenetic regulation of Thy-1 is a novel and potentially reversible mechanism in fibrosis that may offer the possibility of new therapeutic options
18389476 Results support the general concept that the function of 'adhesion molecules' in particular of Thy-1, may not only be to provide mechanical support but also regulate neutrophil functions such as extravasation and recruitment of additional neutrophils.
18242515 All the tumor specimens and 91.6% of blood samples from liver cancer patients bore the CD45(-)CD90+ population, which could generate tumor nodules in immunodeficient mice
17952444 Thy1-negative NBL patients have a significantly impaired overall survival compared with Thy1-positive NBL patients. Thus, Thy1 seemed to be a marker with a specific prognostic value in NBL patients.
17884967 Thy-1 is not a marker of oval cells but is present on a subpopulation of myofibroblasts/stellate cells.
17243294 the distribution and proportion of CD90 positive cells in thyroid associated ophthalmopathy (TAO) and normal orbital tissue
17007050 Expression of Thy1 decreased in differentiated ADSC and BMSC. Expression of albumin, CYP2E1, and CYP3A4 increased in differentiated BMSC and ADSC. Hepatic gene activation may involve increased C/EBPbeta and HNF4alpha.
16531284 Thy 1 mRNA levels do not reflect the number of RGCs present and extend this to include a parallel decrease in Thy1 protein levels.
16374458 Role of endothelial cell receptor Thy1 in cell adhesion was shown.
16007174 THY1 is a good candidate tumour suppressor gene in nasopharyngeal carcinoma, which is significantly associated with lymph node metastases.
15897908 new pair of adhesion molecules, Thy-1 and alphavbeta3, identified that mediate the interaction of melanoma cells and activated endothelial cells
15850796 results indicate that alphaX-beta2 specifically interacts with Thy-1
15218185 IE or E gene products of human cytomegalovirus induce a so far unidentified soluble factor that mediates Thy-1 downregulation.
15104276 THY1 can be designated as a putative tumor suppressor gene for human ovarian cancer.
15004192 The interaction between Thy-1 and Mac-1 is involved in the adhesion of leukocytes to activated endothelial cells as well as in subsequent transendothelial migration of leukocytes into the perivascular tissue.
14507638 Fibroblast Thy-1 display pre-determines lineage to a contractile or lipid-like phenotype in the human myometrium and orbit.
12781446 THY1 is a putative tumor suppressor gene for ovarian cancer; and THBS1, SPARC, and FN1 are genes associated with the regulation of in vivo tumor growth rate
12074634 Thy-1/Thy-1 ligand interaction may play a role in adhesion of melanoma cells to endothelial cells
11860231 Review article on CD90 structure and function.
10708443 HIV Gag proteins adopt a ring-like supramolecular organization at sites of intercellular contacts and co-localize with CD63 tetraspanin and raft components GM1, Thy-1, and CD59

AA Sequence

MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVP      1 - 70
EHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNT     71 - 140
SWLLLLLLSLSLLQATDFMSL                                                     141 - 161
//

Text Mined References (170)

PMID Year Title
26329007 2015 CD90 is upregulated in gastric cancer tissues and inhibits gastric cancer cell apoptosis by modulating the expression level of SPARC protein.
26272696 2015 CD90+ liver cancer cells modulate endothelial cell phenotype through the release of exosomes containing H19 lncRNA.
26191205 2015 Isolation and characterization of CD105+/CD90+ subpopulation in breast cancer MDA-MB-231 cell line.
26147640 2015 THY-1 Cell Surface Antigen (CD90) Has an Important Role in the Initial Stage of Human Cytomegalovirus Infection.
25806121 2015 Glioblastoma specific antigens, GD2 and CD90, are not involved in cancer stemness.
25672610 2015 Evidence of CD90+CXCR4+ cells as circulating tumor stem cells in hepatocellular carcinoma.
25536077 2014 Overexpression of CD90 (Thy-1) in pancreatic adenocarcinoma present in the tumor microenvironment.
25416548 2015 Thy1 (CD90) controls adipogenesis by regulating activity of the Src family kinase, Fyn.
25300435 2014 Relative roles of CD90 and c-kit to the regenerative efficacy of cardiosphere-derived cells in humans and in a mouse model of myocardial infarction.
25300130 2014 Thy-1 modulates neurological cell-cell and cell-matrix interactions through multiple molecular interactions.
25216363 2014 Dynamic catch of a Thy-1-?5?1+syndecan-4 trimolecular complex.
25168019 2015 Aberrant expression of cancer stem cell markers (CD44, CD90, and CD133) contributes to disease progression and reduced survival in hepatoblastoma patients: 4-year survival data.
25070848 2014 TLR4 activation enhances the PD-L1-mediated tolerogenic capacity of colonic CD90+ stromal cells.
25061736 2014 Wnt/?-catenin aids in regulating the proliferation of hepG2 cells mediated by thy-1.
25050599 2015 CD90(+) human dermal stromal cells are potent inducers of FoxP3(+) regulatory T cells.
24838329 2014 CD90 expression in atypical meningiomas and meningioma metastasis.
24751333 2014 Expression of CD90, CD96, CD117, and CD123 on different hematopoietic cell populations from pediatric patients with acute myeloid leukemia.
24702884 2014 Investigation of diagnostic utility and expression profiles of stem cell markers (CD133 and CD90) in hepatocellular carcinoma, small cell dysplasia, and cirrhosis.
24194916 2013 The landscape of candidate driver genes differs between male and female breast cancer.
24116172 2013 The expression of CD90/Thy-1 in hepatocellular carcinoma: an in vivo and in vitro study.
24101104 2013 Identification of CD90 as a marker for lung cancer stem cells in A549 and H446 cell lines.
24045552 2013 CD90 is a diagnostic marker to differentiate between malignant pleural mesothelioma and lung carcinoma with immunohistochemistry.
23890382 2013 Thy-1-interacting molecules and cellular signaling in cis and trans.
23613866 2013 Thy-1-induced migration inhibition in vascular endothelial cells through reducing the RhoA activity.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23438193 2013 Positive correlation of Oct4 and ABCG2 to chemotherapeutic resistance in CD90(+)CD133(+) liver cancer stem cells.
23382045 2013 A CD90(+) tumor-initiating cell population with an aggressive signature and metastatic capacity in esophageal cancer.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23358110 2013 Effect of the GPI anchor of human Thy-1 on antibody recognition and function.
23237599 2013 BORIS, brother of the regulator of imprinted sites, is aberrantly expressed in hepatocellular carcinoma.
23159525 2013 Melanoma cells use Thy-1 (CD90) on endothelial cells for metastasis formation.
22952721 2012 Synovial fluid progenitors expressing CD90+ from normal but not osteoarthritic joints undergo chondrogenic differentiation without micro-mass culture.
22938014 2012 Hypoxia-induced DNA hypermethylation in human pulmonary fibroblasts is associated with Thy-1 promoter methylation and the development of a pro-fibrotic phenotype.
22807289 2013 Soluble CD90 as a potential marker of pulmonary involvement in systemic sclerosis.
22799330 2012 Up-regulation of thy-1 promotes invasion and metastasis of hepatocarcinomas.
22426060 2012 CD90 is identified as a marker for cancer stem cells in high-grade gliomas using tissue microarrays.
22210915 2012 Thy-1 (CD90) is an interacting partner for CD97 on activated endothelial cells.
22203689 2012 CD90 is identified as a candidate marker for cancer stem cells in primary high-grade gliomas using tissue microarrays.
22184726 2012 Human CD90 identifies Th17/Tc17 T cell subsets that are depleted in HIV-infected patients.
21743497 2012 Trastuzumab (herceptin) targets gastric cancer stem cells characterized by CD90 phenotype.
21577212 2011 Absence of Thy-1 results in TGF-? induced MMP-9 expression and confers a profibrotic phenotype to human lung fibroblasts.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21272924 2011 Overexpression of Thy1/CD90 in human hepatocellular carcinoma is associated with HBV infection and poor prognosis.
20562849 2010 CD90/THY1 is overexpressed in prostate cancer-associated fibroblasts and could serve as a cancer biomarker.
20478055 2010 Evaluation of 6 candidate genes on chromosome 11q23 for coeliac disease susceptibility: a case control study.
20463011 2010 Thy-1-integrin alphav beta5 interactions inhibit lung fibroblast contraction-induced latent transforming growth factor-beta1 activation and myofibroblast differentiation.
20403334 2010 Anomalous expression of Thy1 (CD90) in B-cell lymphoma cells and proliferation inhibition by anti-Thy1 antibody treatment.
20043075 2010 An 8-gene signature, including methylated and down-regulated glutathione peroxidase 3, of gastric cancer.
19921696 2010 Functional characterization of THY1 as a tumor suppressor gene with antiinvasive activity in nasopharyngeal carcinoma.
19737398 2009 Gene expression down-regulation in CD90+ prostate tumor-associated stromal cells involves potential organ-specific genes.
19724880 2009 Identification of sex hormone binding globulin-interacting proteins in the brain using phage display screening.
19615261 2009 [Significance of expression of THY1 protein in epithelial ovarian cancer].
19538887 2009 [Expression of THY1 gene in epithelial ovarian cancer].
19422052 Roles and regulation of Thy-1, a context-dependent modulator of cell phenotype.
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19341705 2009 CD90 and CD110 correlate with cancer stem cell potentials in human T-acute lymphoblastic leukemia cells.
19324083 2009 Role of mitogen-activated protein kinases in Thy-1-induced T-lymphocyte activation.
19296231 2009 CD90 Expression on human primary cells and elimination of contaminating fibroblasts from cell cultures.
19267366 2009 Tumor-promoting phenotype of CD90hi prostate cancer-associated fibroblasts.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
19007822 2009 Getting a grip on Thy-1 signaling.
18985728 2009 A decreased positivity for CD90 on human mesenchymal stromal cells (MSCs) is associated with a loss of immunosuppressive activity by MSCs.
18976167 2008 Evidence for enhanced Thy-1 (CD90) expression in orbital fibroblasts of patients with Graves' ophthalmopathy.
18676775 2009 Thy1 up-regulates FasL expression in lung myofibroblasts via Src family kinases.
18556592 2008 Thy-1 promoter hypermethylation: a novel epigenetic pathogenic mechanism in pulmonary fibrosis.
18389476 2008 Human Thy-1 induces secretion of matrix metalloproteinase-9 and CXCL8 from human neutrophils.
18346467 2008 Direct Thy-1/alphaVbeta3 integrin interaction mediates neuron to astrocyte communication.
18242515 2008 Significance of CD90+ cancer stem cells in human liver cancer.
18202976 2008 Loss of Thy-1 (CD90) antigen expression on mesenchymal stromal cells from hematologic malignancies is induced by in vitro angiogenic stimuli and is associated with peculiar functional and phenotypic characteristics.
17983836 2007 In leukapheresis products from non-Hodgkin's lymphoma patients, the immature hematopoietic progenitors show higher CD90 and CD34 antigenic expression.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17952444 2008 Lack of Thy1 (CD90) expression in neuroblastomas is correlated with impaired survival.
17884967 2007 Thy-1 is expressed in hepatic myofibroblasts and not oval cells in stem cell-mediated liver regeneration.
17534660 2007 Thy-1 as a potential novel diagnostic marker for gastrointestinal stromal tumors.
17243294 2006 [The study of CD90 expressing in orbital fibroblasts of thyroid associated ophthalmopathy].
17007050 2006 Hepatogenic differentiation of human mesenchymal stem cells from adipose tissue in comparison with bone marrow mesenchymal stem cells.
16769813 2006 Hepatic progenitor cells in human fetal liver express the oval cell marker Thy-1.
16704635 2006 Expression of CD90 on keratinocyte stem/progenitor cells.
16573842 2006 Decreased CD90 expression in human mesenchymal stem cells by applying mechanical stimulation.
16531284 2006 Downregulation of Thy1 in retinal ganglion cells in experimental glaucoma.
16381901 2006 The LIFEdb database in 2006.
16374458 2006 Increased neutrophil adherence in psoriasis: role of the human endothelial cell receptor Thy-1 (CD90).
16102586 2005 THY-1 induction is associated with up-regulation of fibronectin and thrombospondin-1 in human ovarian cancer.
16007174 2005 THY1 is a candidate tumour suppressor gene with decreased expression in metastatic nasopharyngeal carcinoma.
15981219 2005 Relationship between Thy-1 expression and cell-cycle distribution in human bone marrow hematopoietic progenitors.
15897908 2005 Interaction of human Thy-1 (CD 90) with the integrin alphavbeta3 (CD51/CD61): an important mechanism mediating melanoma cell adhesion to activated endothelium.
15850796 2005 Characterization of alphaX I-domain binding to Thy-1.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15218185 2004 Downregulation of the cellular adhesion molecule Thy-1 (CD90) by cytomegalovirus infection of human fibroblasts.
15140607 2004 Thy1 expression in the brain is affected by iron and is decreased in Restless Legs Syndrome.
15104276 2004 The role of the THY1 gene in human ovarian cancer suppression based on transfection studies.
15093746 2004 Thy-1 regulates fibroblast focal adhesions, cytoskeletal organization and migration through modulation of p190 RhoGAP and Rho GTPase activity.
15079812 2004 Efficient transduction and selection of human T-lymphocytes with bicistronic Thy1/HSV1-TK retroviral vector produced by a human packaging cell line.
15059143 2004 CD90/Thy-1 is preferentially expressed on blast cells of high risk acute myeloid leukaemias.
15004192 2004 Human Thy-1 (CD90) on activated endothelial cells is a counterreceptor for the leukocyte integrin Mac-1 (CD11b/CD18).
14757759 2004 Lateral membrane biogenesis in human bronchial epithelial cells requires 190-kDa ankyrin-G.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14507638 2003 Thy-1 expression in human fibroblast subsets defines myofibroblastic or lipofibroblastic phenotypes.
12781446 2003 THY1 expression is associated with tumor suppression of human ovarian cancer.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12074634 2002 The Thy-1/Thy-1 ligand interaction is involved in binding of melanoma cells to activated Thy-1- positive microvascular endothelial cells.
11860231 CD90.
11485909 2001 The perifollicular and marginal zones of the human splenic white pulp : do fibroblasts guide lymphocyte immigration?
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11224484 2001 Impact of CD133 (AC133) and CD90 expression analysis for acute leukemia immunophenotyping.
11076863 2000 DNA cloning using in vitro site-specific recombination.
11069627 2000 A ligand of human thy-1 is localized on polymorphonuclear leukocytes and monocytes and mediates the binding to activated thy-1-positive microvascular endothelial cells and fibroblasts.
10944468 2000 cDNA cloning by amplification of circularized first strand cDNAs reveals non-IRE-regulated iron-responsive mRNAs.
10708443 2000 Evidence for budding of human immunodeficiency virus type 1 selectively from glycolipid-enriched membrane lipid rafts.
10571119 1999 Detection of human soluble Thy-1 in serum by ELISA. Fibroblasts and activated endothelial cells are a possible source of soluble Thy-1 in serum.
10517174 1999 Thy-1 differentiation protein and monocyte-derived cells during regeneration and aging of human placental villi.
10229838 1999 Cleavage of the glycosylphosphatidylinositol anchor affects the reactivity of thy-1 with antibodies.
10089008 1999 Immunohistochemical localization of the cell adhesion molecules Thy-1 and L1 in the human prefrontal cortex patients with schizophrenia, bipolar disorder, and depression.
9885439 1998 Flow cytometric analysis of Thy-1 expression in myelodysplastic syndrome.
9695410 1998 Frequent expression of human Thy-1 antigen on pre-B cell acute lymphoblastic leukemia with t(9;22).
9401277 1997 Flow cytometric analysis of Thy-1 expression in CD34-positive acute leukemia.
9261934 1997 Decrease in Thy-1 expression on peripheral CD34 positive cells induced by G-CSF mobilization. The Tohoku Children Leukemia Study Group.
9225063 1997 Thy-1 expression on blast cells from adult patients with acute myeloid leukemia.
9129012 1997 Lack of expression of Thy-1 (CD90) on acute myeloid leukemia cells with long-term proliferative ability in vitro and in vivo.
8752941 1996 Human Thy-1 is cytokine-inducible on vascular endothelial cells and is a signaling molecule regulated by protein kinase C.
8662072 1996 The mouse CD7 gene: identification of a new element common to the human CD7 and mouse Thy-1 promoters.
8547671 1996 Expression of Thy-1 antigen (CDw90) on adult acute leukemia blast cells.
8527803 1995 Detection of MspI RFLP in human THY1 gene by the polymerase chain reaction.
8104555 1993 Comparative analysis of the N-glycans of rat, mouse and human Thy-1. Site-specific oligosaccharide patterns of neural Thy-1, a member of the immunoglobulin superfamily.
8097308 Developmental pattern of Thy-1 immunoreactivity in the human kidney and the application to pediatric renal neoplasms.
7780000 1995 Quantitative evaluation of the cell cycle-related retinoblastoma protein and localization of Thy-1 differentiation protein and macrophages during follicular development and atresia, and in human corpora lutea.
7683034 1993 Expression of Thy-1 on human hematopoietic progenitor cells.
7540889 1995 Characterization of Thy-1 (CDw90) expression in CD34+ acute leukemia.
7539435 1995 The glycophosphatidylinositol anchor affects the conformation of Thy-1 protein.
7513706 1994 Distinct intracellular localization of Lck and Fyn protein tyrosine kinases in human T lymphocytes.
7513197 1994 Thy-1 expression is linked to functional properties of primitive hematopoietic progenitor cells from human umbilical cord blood.
7479964 1995 An astrocytic binding site for neuronal Thy-1 and its effect on neurite outgrowth.
6207102 1984 Antigenic determinant(s) shared by the human Thy 1 and human IgG.
6153212 1980 Isolation and partial characterization of the human homologue of Thy-1.
6152662 Biochemical characterization of human Thy-1.
6151574 A monoclonal antibody recognizing human Thy-1: distribution on human and non-human primate haematopoietic cells.
6134683 1983 Expression of Thy-1 antigen on human melanoma cells.
6134665 1983 Human Thy-1 antigen: cell surface expression on early T and B lymphocytes.
6130472 1983 Thy-1 cDNA sequence suggests a novel regulatory mechanism.
6125472 1982 A human thy-1-like antigen expressed on cultured leukemic T-cells.
6124880 1982 Molecular comparison of mouse Thy-1 and its human homologue.
6121610 1982 Human Thy-1: expression on the cell surface of neuronal and glial cells.
6119980 1981 Biochemical characterization including amino acid and carbohydrate compositions of canine and human brain Thy-1 antigen.
6119137 1981 Distribution of Thy-1 in human brain: immunofluorescence and absorption analyses with a monoclonal antibody.
3917857 1985 T cell antigen receptors and the immunoglobulin supergene family.
3104795 1987 Thy-1-mediated T-cell activation requires co-expression of CD3/Ti complex.
2906907 1988 Expression of the Thy-1 gene in human T lymphoid cell lines.
2906906 1988 Detection of Thy-1 on cell surface of human T lymphoid cell lines by a monoclonal antibody.
2902051 1988 DNA polymorphism in the human Thy-1 gene.
2900838 1988 Characterization of a hydrophilic form of Thy-1 purified from human cerebrospinal fluid.
2885264 1986 Release of Thy-1 from human and murine T-cell lines by a specific phospholipase.
2884261 1987 Differential expression of the human Thy-1 gene in rodent-human somatic cell hybrids [corrected].
2865325 1985 Role of human chromosome 11 in determining surface antigenic phenotype of normal and malignant cells. Somatic cell genetic analysis of eight antigens, including putative human Thy-1.
2864756 1985 Isolation and characterization of Thy 1 homologue from human thymus.
2864690 1985 The human Thy-1 gene: structure and chromosomal location.
2864289 1985 Thy-1: a hydrophobic transmembrane segment at the carboxyl terminus.
2863819 1985 Chromosomal localization of the human Thy-1 gene.
2566388 1989 Detection of a Thy-1 precursor in human T lymphoma cell lines.
2451568 1988 Expression of Thy-1 and effect of phosphatidylinositol-specific phospholipase C on primate and murine cell lines.
1982251 Non-HLA genetic factors and insulin dependent diabetes mellitus in the Japanese: TCRA, TCRB and TCRG, INS, THY1, CD3D and ETS1.
1968887 1990 Determination of the molecular nature and cellular localization of Thy-1 in human renal tissue.
1968831 1990 Tissue-specific control elements of the Thy-1 gene.
1363523 1992 Differential expression of the mouse and human Thy-1 gene in embryonal carcinoma cells.
1361252 1992 Novel immunohistochemical markers of human renal allograft dysfunction--antithrombin III, Thy-1, urokinase, and alpha-smooth muscle actin.
1351058 1992 The glycophosphatidylinositol-anchored Thy-1 molecule interacts with the p60fyn protein tyrosine kinase in T cells.
1347022 1992 Thy-1 multimerization is correlated with neurite outgrowth.
1281618 1992 Cutaneous expression of Thy-1 in mycosis fungoides.