Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.20
PubTator Score 0.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 2.9e-07
glioblastoma 1.100 1.7e-08
group 3 medulloblastoma 1.100 4.6e-02
osteosarcoma 1.744 9.7e-05
ovarian cancer 1.800 2.1e-05
pediatric high grade glioma 1.100 3.3e-07
Rheumatoid arthritis 1.900 4.2e-04

AA Sequence

MCDIEEATNQLLDVNLHENQKSVQVTESDLGSESELLVTIGATVPTGFEQTAADEVREKLGSSCKISRDR      1 - 70
GKIYFVISVESLAQVHCLRSVDNLFVVVQEFQDYQFKQTKEEVLKDFEDLAGKLPWSNPLKVWKINASFK     71 - 140
KKKAKRKKINQNSSKEKINNGQEVKIDQRNVKKEFTSHALDSHILDYYENPAIKEDVSTLIGDDLASCKD    141 - 210
ETDESSKEETEPQVLKFRVTCNRAGEKHCFTSNEAARDFGGAVQDYFKWKADMTNFDVEVLLNIHDNEVI    211 - 280
VGIALTEESLHRRNITHFGPTTLRSTLAYGMLRLCDPLPYDIIVDPMCGTGAIPIEGATEWSDCFHIAGD    281 - 350
NNPLAVNRAANNIASLLTKSQIKEGKPSWGLPIDAVQWDICNLPLRTGSVDIIVTDLPFGKRMGSKKRNW    351 - 420
NLYPACLREMSRVCTPTTGRAVLLTQDTKCFTKALSGMRHVWRKVDTVWVNVGGLRAAVYVLIRTPQAFV    421 - 490
HPSEQDGERGTLWQCKE                                                         491 - 507
//

Text Mined References (8)

PMID Year Title