Property Summary

NCBI Gene PubMed Count 8
PubMed Score 617.35
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8520 1.0e-05
group 4 medulloblastoma 1855 4.3e-03

Expression

  Differential Expression (2)

Disease log2 FC p
group 4 medulloblastoma 1.100 4.3e-03
ovarian cancer -1.500 1.0e-05

Gene RIF (2)

AA Sequence

MAAPAQQTTQPGGGKRKGKAQYVLAKRARRCDAGGPRQLEPGLQGILITCNMNERKCVEEAYSLLNEYGD      1 - 70
DMYGPEKFTDKDQQPSGSEGEDDDAEAALKKEVGDIKASTEMRLRRFQSVESGANNVVFIRTLGIEPEKL     71 - 140
VHHILQDMYKTKKKKTRVILRMLPISGTCKAFLEDMKKYAETFLEPWFKAPNKGTFQIVYKSRNNSHVNR    141 - 210
EEVIRELAGIVCTLNSENKVDLTNPQYTVVVEIIKAVCCLSVVKDYMLFRKYNLQEVVKSPKDPSQLNSK    211 - 280
QGNGKEAKLESADKSDQNNTAEGKNNQQVPENTEELGQTKPTSNPQVVNEGGAKPELASQATEGSKSNEN    281 - 350
DFS                                                                       351 - 353
//

Text Mined References (18)

PMID Year Title