Property Summary

NCBI Gene PubMed Count 21
PubMed Score 213.57
PubTator Score 34.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
medulloblastoma, large-cell 1.100 1.4e-03
autosomal dominant Emery-Dreifuss muscul... 1.361 9.7e-04
Atopic dermatitis -3.900 2.8e-03
adrenocortical adenoma -1.113 4.3e-02
adrenocortical carcinoma -1.381 4.2e-04
pancreatic ductal adenocarcinoma liver m... -3.138 2.4e-03
breast carcinoma -2.500 1.5e-03
group 3 medulloblastoma 1.400 2.7e-02
non primary Sjogren syndrome sicca 1.900 5.7e-03
psoriasis -4.100 2.7e-09
inflammatory breast cancer -2.700 3.2e-03
ductal carcinoma in situ -4.100 8.2e-04
invasive ductal carcinoma -5.200 1.6e-03
ovarian cancer -1.100 2.7e-05

Synonym

Accession Q92748 B2R4W7
Symbols S14
Lpgp
THRP
LPGP1
SPOT14

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

PMID Text
25472762 In human breast cancer cell lines, S14 expression was highest in those representing the luminal subtype compared to those cell lines with basal characteristics.
21821901 N-terminally truncated human Thrsp and its selenomethionyl derivative were collected to 4.0, 3.0 and 3.6 A resolution
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18299245 human Spot 14 protein might regulate the p53 target gene, p21(WAF1/Cip1), via its direct interaction with the thyroid receptor or other p53 coactivators, such as Zac1.
17418816 These findings provide a molecular rationale for the role of hS14 in TR-dependent transcriptional activation of the expression of specific genes.
12960053 significantly greater thyroid hormone response for the human promoter, compared with the rat.

AA Sequence

MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDV      1 - 70
DHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQE     71 - 140
MTGQVW                                                                    141 - 146
//

Text Mined References (22)

PMID Year Title
25472762 2014 Modulation of tumor fatty acids, through overexpression or loss of thyroid hormone responsive protein spot 14 is associated with altered growth and metastasis.
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
21821901 2011 Expression, purification and preliminary crystallographic analysis of human thyroid hormone responsive protein.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18299245 2008 Human Spot 14 protein is a p53-dependent transcriptional coactivator via the recruitment of thyroid receptor and Zac1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17418816 2007 Human spot 14 protein interacts physically and functionally with the thyroid receptor.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12960053 2003 Human spot 14 glucose and thyroid hormone response: characterization and thyroid hormone response element identification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9777755 1998 "Spot 14" protein: a metabolic integrator in normal and neoplastic cells.
9618526 1998 The "Spot 14" gene resides on the telomeric end of the 11q13 amplicon and is expressed in lipogenic breast cancers: implications for control of tumor metabolism.
9389499 1997 Spot 14 protein-protein interactions: evidence for both homo- and heterodimer formation in vivo.
9371405 1997 Assignment of the "spot 14" gene (THRSP) to human chromosome band 11q13.5 by in situ hybridization.
9186528 1997 Assignment of thyroid hormone responsive SPOT 14 homolog (THRSP) to human chromosome 11 bands q13.5-->q14.1 by in situ hybridization.
9027365 1997 Cloning, expression and regulation of the human S14 gene.
9003802 1997 Cloning and initial characterization of human and mouse Spot 14 genes.