Property Summary

NCBI Gene PubMed Count 23
PubMed Score 221.46
PubTator Score 34.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical adenoma -1.113 4.3e-02
adrenocortical carcinoma -1.381 4.2e-04
Atopic dermatitis -2.500 4.7e-03
autosomal dominant Emery-Dreifuss muscul... 1.361 9.7e-04
breast carcinoma -2.500 1.5e-03
ductal carcinoma in situ -2.700 1.6e-04
group 3 medulloblastoma 1.400 2.7e-02
inflammatory breast cancer -2.700 3.2e-03
invasive ductal carcinoma -2.900 7.8e-04
medulloblastoma, large-cell 1.100 1.4e-03
non primary Sjogren syndrome sicca 1.900 5.7e-03
ovarian cancer -1.100 2.7e-05
pancreatic ductal adenocarcinoma liver m... -3.138 2.4e-03
psoriasis -2.100 8.1e-16

Gene RIF (8)

AA Sequence

MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDV      1 - 70
DHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQE     71 - 140
MTGQVW                                                                    141 - 146
//

Text Mined References (24)

PMID Year Title