Property Summary

NCBI Gene PubMed Count 209
PubMed Score 609.94
PubTator Score 407.03

Knowledge Summary

Patent (75,168)

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Peripheral vascular disease 90 0.0 2.0

Expression

  Differential Expression (27)

Disease log2 FC p
astrocytic glioma -2.200 3.2e-03
ependymoma -2.700 3.1e-03
oligodendroglioma -2.000 2.7e-15
psoriasis 1.200 4.3e-04
glioblastoma -3.900 6.7e-05
osteosarcoma -1.324 2.7e-02
group 4 medulloblastoma -4.800 1.0e-06
cystic fibrosis -3.285 3.8e-06
atypical teratoid / rhabdoid tumor -4.600 7.8e-09
medulloblastoma, large-cell -5.500 2.4e-06
primitive neuroectodermal tumor -3.700 2.8e-04
Becker muscular dystrophy -1.040 1.3e-02
hereditary spastic paraplegia -1.034 2.2e-02
adrenocortical carcinoma -1.811 3.2e-03
intraductal papillary-mucinous adenoma (... 1.500 6.6e-04
lung cancer -2.300 5.8e-04
colon cancer -2.400 4.1e-09
interstitial cystitis -2.600 2.2e-05
pediatric high grade glioma -2.700 4.8e-04
Breast cancer -1.800 1.5e-08
invasive ductal carcinoma -2.000 6.3e-03
lung carcinoma -1.300 3.9e-17
breast carcinoma -1.300 5.0e-18
ductal carcinoma in situ -1.800 1.7e-04
ulcerative colitis -1.300 1.0e-02
ovarian cancer 1.200 3.6e-03
head and neck cancer -1.200 2.5e-04

Protein-protein Interaction (7)

MLP Assay (17)

AID Type Active / Inconclusive / Inactive Description
1469 confirmatory 183 / 1030 / 281374 qHTS for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
1479 confirmatory 816 / 3497 / 278274 Total Fluorescence Counterscreen for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
1485 summary 1 / 0 / 0 Quantitative High-Throughput Screen for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2: Summary
1567 confirmatory 8 / 61 / 34 Cell-based Gene Reporter Secondary Assay to Characterize qHTS Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
1568 confirmatory 6 / 19 / 78 Cell Viability Secondary Assay to Characterize qHTS Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
1570 confirmatory 17 / 59 / 36 Concentration Response Confirmation Assay for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2, Fluorescein Fluoroprobe
1571 confirmatory 8 / 21 / 83 Total Fluorescence Confirmation Counterscreen for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2, Fluorescein Fluoroprobe
1572 confirmatory 6 / 13 / 93 Total Fluorescence Confirmation Counterscreen for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
1573 confirmatory 27 / 65 / 20 Concentration Response Confirmation Assay for Inhibitors of the Interaction of Thyroid Hormone Receptor and Steroid Receptor Coregulator 2
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
More...

Gene RIF (134)

PMID Text
26350179 Loss of heterozygosity in THRB and its proximal microsatellite markers may play a role in tumorigenesis and development in invasive breast cancer.
26273722 It is demonstrated in this article that the A234T mutation in the THR-beta gene can cause the thyroid hormone resistance syndrome.
26041374 p.H271D mutation associated with resistance thyroid hormone syndrome
26029931 The current study aimed to investigate whether TRs may be specifically expressed in BRCA1 associated cancer cases.
26003825 Down-regulation of THRbeta correlates with the reduction of all markers of differentiation and is associated with overexpression of some miRNAs supposed to play a role in thyroid tumorigenesis.
25924236 propose that the mutated C-terminal region of TRbeta1 could function as an "onco-domain"
25820519 Results showed that triple negative breast cancer patients expressed low level of THRB which was associated with poor outcome and enhanced resistance to both docetaxel and doxorubicin treatment.
25738994 diagnosis was confirmed by direct THRB sequencing that revealed 2 novel mutations: the heterozygous p.Ala317Ser in subject 1 and the heterozygous p.Arg438Pro in subject 2
25572392 data demonstrate that TR sumoylation is required for activation of the Wnt canonical signaling pathway during preadipocyte proliferation and enhances the PPARgamma signaling that promotes differentiation
25502991 cases suggested that certain RTHbeta mutants such as p.R316C might show very mild syndrome of inappropriate secretion of thyrotropin in spite of having apparent peripheral resistance to thyroid hormone
25302749 Its promoter methylation may be involved in the development of gastric cancer.
25156012 down-regulated in hepatocellular carcinoma and precancerous peritumoral tissue
25063548 data indicated altered mineral metabolism in adults and children with resistance to thyroid hormone due to mutations in the THRB gene
25019984 Coordinated regulation of transcription and alternative splicing by the thyroid hormone receptor.Thyroid hormone receptor stimulates target gene transcription by binding to the thyroid hormone-response element in the presence of triiodothyronine.
24849932 CpG methylation is not the major mechanism contributing to decreased THRB expression in ccRCC
24796297 miR-424 or miR-503 mediate anti-proliferative and anti-invasive actions of thyroid hormone receptor beta
24722129 The clinical and biochemical characteristics of our samples of Mediterranean populations with thyroid hormone resistance were similar to those previously described. Interestingly, in our populations we identified four novel mutations in the TRbeta gene
24673558 Transactivation of reporter genes in response to T4 thyroid hormone was dependent on the thyroid hormone receptor subtypes in human cells.
24434154 Results showthat thyroid hormone receptor beta1 (TRbeta1) mRNA expression was significantly reduced in gastric cancer specimens and the methylation of promoter of TRbeta1 gene in gastric cancer tissues was significantly higher than in adjacent normal tissues.
24325866 TRalpha1 and TRbeta1, preferentially partner with distinct panels of auxiliary proteins.
24217081 A heterozygous mutation at codon 350 located in exon 9 of the THRB gene was detected in all the affected members of the family. It is important to consider thyroid hormone levels in association with TSH levels to prevent inappropriate treatmen
24136366 Adenovirus E1A 55R functions as a strong co-activator of TR-dependent transcription.
24121026 T3 throid hormone enhanced the recruitment of the TRbeta1/Oct-1 complex on Octamer-transcription factor-1 site within cyclin D1 promoter.
24058409 Using several human ROP enhancer/promoter-luciferase reporter constructs, the study found that thyroid hormone receptor beta 2 increased luciferase activities through the 5'-UTR and intron 3-4 region.
24036060 Alzheimer's disease brain tissues with elevated neuroserpin protein also showed increased expression of THRbeta1 and HuD
23922917 SIRT1 stimulates THRB1 activity in a manner that is independent of PGC-1alpha but requires SIRT1 deacetylase activity.
23736295 Data indicate that 3,5-diiodothyronine T2 activates the thyroid hormone receptor beta1 (TRbeta1).
23731250 TRb expression in FTC cells decreased cancer cell proliferation, impeded tumor cell migration, and inhibited tumor growth in vivo through downregulation of the AKT-mTOR-p70 S6P signaling pathway and suppression of VEGF expression
23629656 a novel inverse recruitment mechanism in which liganded TRbeta recruits corepressors to inhibit PLA2g2a expression.
23558175 A combination of isoform-specific recruitment and tissue-specific expression of these newly identified coregulator candidates serves to customize TR function for different biological purposes in different cell types.
23416078 TR-beta and LXR-alpha competitively up-regulate the human Seladin-1 promoter, sharing the same response element, site A.
23300972 thyroid hormone receptor action varies by subtype and could could influence physiologic and pharmacologic responses to THs and selective TR modulators (STRMs)
23271024 Studies indicate that thyroid hormone receptors alpha and beta (TRTHRA and THRB) genes mutations has been identified in thyroid tumours.
23195042 we report a novel mutation in the THRb gene [c.986C>T (p.Thr329Ile)] in a woman and her daughter, who was also a carrier of the same mutation.
23183175 THRB mRNA expression in DTC was 90% lower than in normal controls, and this decrease was associated with a higher tumor/lymph node staging.
23136537 THRB intronic SNPs can provide useful information on chemoradiotherapy-related severe myelotoxicity in patients with esophageal squamous cell carcinoma
22974658 TRbeta1 binds PGC-1alpha in a second ligand and LxxLL motif independent mode and show this interaction requires the TRbeta1 N-terminal domain and the PGC-1alpha N-terminal activation domain at amino acids 1-130.
22930759 conjugation of SUMO to TR has a TR-isoform preference and is important for T3-dependent gene induction and repression.
22560525 Genes in the erythroid differentiation and cell cycle regulation pathways influence interindividual variation in RBC indices. Our results provide insights into the molecular basis underlying variation in RBC traits.
22551329 We document a congenital disorder of cone function characterized by severely reduced L- and M-cone responses and increased S-cone responses caused by deleterious mutations in the THRbeta2 gene in thyroid resistant patients.
22319036 report of three new subjects, from two families, in whom resistance to thyroid hormone was associated with homozygous mutations in the THRB gene; report strengthens the concept that the mutated TRbeta interferes with the function of the TRalpha1 in humans
22253701 Firefly luciferase cDNA sequence mediates the phorbol 12-O-tetradecanoate-13-acetate-induced transcriptional activity, which is inhibited by thyroid hormone/thyroid hormone receptor.
22212731 One SNP 5' of the thyroid hormone receptor-beta gene was associated with BDR in the childhood population and two adult populations (P-value=0.0012-
21994129 The TR/DKK4/Wnt/beta-catenin cascade influences the proliferation and migration of hepatoma cells during the metastasis process and support a tumor suppressor role of the thyroid hormone receptor.
21871106 SNPs in intron control region (ICR) of THRB gene in resistance to thyroid hormone(RTH)syndrome; in index case of PRTH a common SNP in ICR stimulates overactivation of TRbeta2 promoter in pituitary cells; it is linked in cis with known R338W coding mutation
21795843 Pathogenic mutations in the thyroid hormone receptor beta gene is associated with thyroid hormone resistance.
21740842 a novel missense mutation in exon 9 of the TRbeta gene was identified in a boy with resistance to thyroid hormone, changing codon 317 from GCT to GAT, 1235C>A or A317D the same mutation was also identified in his mother
21703645 THRB mutations were found in 3 cases of familial thyroid hormone resistance: R243Q, R320C, R429Q. They had decreased response to T3. R243Q & R320C had a strong dominant negative effect.
21622534 TR mutations from renal clear cell carcinoma and hepatocellular carcinoma may play tissue-specific roles in carcinogenesis.
21622532 charge clusters allow wild-type thyroid hormone receptor beta 2 to assume a conformation compatible with its mode of multiple contact coactivator recruitment
21530542 Although residues at position 280 do not interact with coactivators or with the ligand, the authors show that its mutations can selectively block coactivator and corepressor binding, and affect hormone binding affinity differently.
21508093 TRbeta dimer/heterodimer interactions influence ligand (125I-T3) association/dissociation kinetic; studies include mutant/recombinant forms of TRbeta, ligand-binding domain of TRbeta, corepressor peptide binding, and heterodimers with RXRalpha.
21402532 recombinant RXR-alpha could effectively bind TRbeta1 to form a heterodimer
21389087 Differential interaction of NCoR1 with TR isoforms accounted for the TR isoform-dependent regulation of adipogenesis and that aberrant interaction of NCoR1 with TR could underlie the pathogenesis of lipid disorders in hypothyroidism.
21323586 TRbeta1 degradation is mediated by the proteasome pathway. kinetics of TRbeta1 degradation is atypical due to the co-existence of more than one TRbeta1 population, located in different cellular compartments and having different stability profiles.
21159845 microRNAs up-regulated in papillary thyroid carcinoma tumors directly inhibit the expression of THRB, an important tumor suppressor gene
21159845 THRB is regulated by 7 out of 8 microRNA genes upregulated in papillary thyroid cancer, including miR-21, miR-146a, miR-221, and miR-181a
21110296 RTH is a rare autosomal-dominant inherited disorder. The majority of cases are caused by a mutation in the thyroid hormone receptor beta gene [3] leading to impaired responsiveness of the tissues to thyroid hormones.
20956942 An important functional role of endogenous corepressors was shown in the suppression of ras-mediated transformation and tumorigenesis by thyroid hormone receptor beta1.
20838640 T3 weakens TRb1 binding to a negative regulatory element in the TSHbeta promoter.
20827662 STC1 induction by thyroid hormone depends on both TRbeta and PI3K activation.
20736347 Thyroid hormone receptors THRbeta and THRalpha1 are down-regulated in skeletal muscle from patients with non-thyroidal illness syndrome secondary to non-septic shock.
20716560 Observational study of gene-disease association. (HuGE Navigator)
20691434 We found TSHR, TRalpha1, TRalpha2 and TRbeta1 mRNA and proteins expressed in human endometrium
20691260 Data show that reduced TRbeta1 expression and tissue hypothyroidism in ccRCC tumors is likely to be involved in the process of carcinogenesis or in maintaining a proliferative advantage to malignant cells.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20470753 A novel isoform, TRbeta4, may modulate T3 action as an endogenous antagonist in the tissue or cellular context, like TRalpha2.
20444926 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20155399 epigenetic inactivation of TRbeta1 through aberrant methylation in lung cancer
20141582 The presence of TRs in the penis provides the biological basis for the direct action of thyroid hormones on this organ.
20082849 ONL001656673
20004952 Thyroid transcription factor 1 expression confers a better prognosis in patients with ovarian cancer.
19926848 The natural TH 3,5,3'-triodothyroacetic acid (Triac) exhibits a previously unrecognized mechanism of TRbeta selectivity.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19903885 Data show that TH treatment promoted rapid and sustained hCCR4 recruitment to the TH-responsive deiodinase 1 promoter and TR co-localizes with hCCR4 in the nucleus and interacts with hCCR4 in 2-hybrid and pull-down assays.
19903799 TR expression in human haematopoietic cells depends on thyroid function status, both hypo- and hyperthyroidism significantly influence clonogenicity and induce apoptosis in CD34(+)-enriched stem cells
19853653 A bioassay to evaluate the thyroid disrupting potential of industrial chemical using human TRalpha or TRbeta in S. cerevisiae is described.
19628582 analysis of isoform-specific transcriptional activity of overlapping target genes that respond to thyroid hormone receptors alpha1 and beta1
19524130 The wide spacing of the NCoR receptor-interacting domains likely allows for potential flexibility in the DNA-bound TR complex in its ability to recruit NCoR.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19439650 The R429Q mutation is associated with selective impairment of thyroid hormone (TH)-mediated gene repression, suggesting that the affected domain, needed for TR homodimerization and corepressor bindinghas a critical role in negative gene regulation by TH.
19422879 Triiodothyronine regulates AKR1B1 gene expression via a thyroxine receptor response element-dependant mechanism and associates liver cancer.
19407221 Thyroid hormone receptor mutations found in renal clear cell carcinomas alter corepressor release and reveal helix 12 as key determinant of corepressor specificity
19378427 No specific T3-binding was observed for the receptor with the A279E mutation. The binding affinity was reduced by 74% in the T327A mutant and by about 50% in the I250T and L440P mutants compared to the WT receptor
19299458 study shows: negative regulation of TRH gene by TH involves acetylation & methylation of specific residues of histone tails & changing amount of TR; impairment to histone modifications in TR mutant F455S was hyperacetylation of specific histone tails
19268523 Data report thirteen patients with Thyroid Hormone Resistance caused by heterozygous mutations of the thyroid hormone receptor beta gene. Seven of the identified mutations correspond to novel substitutions.
19211732 Transcriptional regulation by TR is mainly mediated by an exchange of corepressor proteins and coactivator proteins.
19160403 the Thyroid hormone beta1 receptor mediates the T3 upregulation of protein synthesis and cell size, together with the cell proliferation and survival, playing a crucial role in the T3 regulation of the PI3K/Akt pathway.
19000767 Our findings suggest that flexibility plays an important role in interaction between the receptor & its coregulators, & point out important aspects of experimental design that should be addressed when using TRbeta ligand binding domain & its agonists.
18844476 Analysis of the T3 receptor genes revealed 15 SNPs, including 7 novel. Only THRB-in9-G/A was associated with higher serum TSH in a large population of Danish twins.
18844476 Observational study of gene-disease association. (HuGE Navigator)
18798561 In this work, a single surface mutation, D355R, was shown to be crucial for converting the modestly stable monomeric ligand binding domain of the human thyroid hormone receptor (TR LBD) into a stable dimer.
18683837 As TRbeta(H435Y) has been found in both resistance to thyroid hormone and pituitary carcinoma, these results serve perhaps as the first example of chemical rescue that targets a mutant protein involved in multiple disease states.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18561095 Mutational analysis of the TRRB gene allows definitive diagnosis of thyroid hormone resistance syndrome, potentially avoiding the need for protracted and expensive pituitary function testing.
18514160 Observational study of gene-disease association. (HuGE Navigator)
18467449 Furin overexpression in some types of hepatocellular carcinomas is TR dependent.
18363280 We report the first case of a woman with resistance to thyroid hormone, which was found to be caused by a missense mutation (V349M) in the TR beta gene.
18239067 Activation of the thyroid hormone receptor beta/retinoid X receptor alpha heterodimer by T(3) stimulated expression of the hepatic leukemia factor, which increases HIF-1alpha gene expression.
17911173 hypermethylation of the TRbeta gene as an alternative gene silencing mechanism is highly prevalent in thyroid cancer
17827792 Generalized resistance to thyroid hormone with chronic thyroiditis with a novel mutation, G347A, of the TR beta gene.
17596672 an insertion mutation in thyroid hormone receptor-beta may have a role in thyroid hormone resistance
17560756 the two systems, TRs and IGF1/IGF1R could also be functionally associated.
17418816 These findings provide a molecular rationale for the role of hS14 in TR-dependent transcriptional activation of the expression of specific genes.
17293442 Mediates Akt activation by T3 in pancreatic beta cells.
17260956 apo THRBs form tetramers in solution which dissociate into dimers upon thyroid hormone T3 binding
17177139 The E333D TRbeta mutation is responsible for the resistance to thyroid hormone syndrome in a case report.
16781732 Thyroid hormone receptor (TR) D-domain has the potential to form functionally important extensions of the DNA-binding domain (DBD) and ligand-binding domain (LBD) or unfold to permit TRs to adapt to different DNA response elements.
16231318 Association of TRbeta1 expression with growth pattern and the presence of K-ras mutations suggest that abnormalities in thyroid hormone signalling involving TRbeta1 play a role in the development of some types of colorectal adenocarcinomas
16099238 Pituitary and peripheral tissue responses to graded doses of liothyronine in 5 affected members of a family with thyroid hormone resistance due to the common TRbeta mutation P453T are reported.
15987841 Modulation of hepatic TRbeta1, a key regulator of gene expression involved in lipid metabolism by soy proteins may be a novel mechanism by which soy components lower blood lipid level and exert their hypocholesterolemic actions.
15886199 a small subset of TRbeta mutations that arise in resistance to thyroid hormone syndrome inhibit both T3 binding and formation of TRbeta homodimers on thyroid hormone response elements
15867011 results suggested that T3 upregulates cellular proliferation on LNCaP cells but not other prostatic carcinoma cells and PZ-HPV-7 and CA-HPV-10 cells express the novel TRbeta1, which locates at cell nuclear membrane
15598685 two novel TRbeta mutations occurring in the same nucleotide
15319359 unliganded TRbeta1 suppresses promoter activity driven by LXRalpha and its ligand, whereas transactivation by T3-bound TRbeta1 is not affected by LXRalpha in the presence or absence of oxysterols
15186611 Most patients with resistance to thyroid hormone carry a mutation in this gene.
15105435 developmental and tissue-specific expression of human thyroid hormone receptor beta1 5'-UTR mRNAs may regulate T3-responsiveness in target tissues by modulating TRbeta protein translation
15080770 novel point mutation, a heterozygous transition c.1031G>C in exon 9 theoretically substituting Gly344Ala results in bone development retardation
14985366 partial dissociation of TR/retinoid X receptor heterodimer complex from the TRE is involved in the suppression of transcription induced by polychlorinated biphenyls
14767065 thyroid hormone receptor-beta cell cycle-dependent expression regulates variable hormone sensitivity
14684607 Except for cardiac hypertrophy, the presence of a germline TR-beta mutation had surprisingly little effect on cardiac function.
14673100 The crystal structure of human thyroid hormone receptor beta at 2.8-A resolution with GC-24 bound explains its agonist activity and unique isoform specificity.
12843201 expression of functionally impaired mutants of THRB1 in papillary carcinomas is rare
12788902 Observational study of gene-disease association. (HuGE Navigator)
12554782 x-ray crystal structures of two hTRbeta ligand-binding domains, Ala 317 Thr and Arg 316 His
12382103 Thrb(PV)/Thrb(PV) mice have severe hearing impairment that is already present at 3 weeks of age. This hearing loss is associated with disruption of postnatal morphogenesis of the tectorial membrane and organ of Corti.
12006711 a point mutation, not anticipated to occur in resistance to thyroid hormone, causes variable phenotypes.
11929097 genetic analysis revealed a novel heterozygous missense mutation at codon 334 of thyroid hormone receptor beta1 in a family with resistance to thyroid hormone
11889175 affected receptor amino acid sequences.lost their trans-activation function and exhibited dominant negative activity.
11861164 neurodevelopmental functions of thyroid hormone signaling
11818500 TR surfaces and conformations required to bind nuclear receptor corepressor

AA Sequence

MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHL      1 - 70
DHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLH     71 - 140
PSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGH    141 - 210
KPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAI    211 - 280
TRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVS    281 - 350
DAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK    351 - 420
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED                                 421 - 461
//

Text Mined References (215)

PMID Year Title
26350179 Loss of heterozygosity in thyroid hormone receptor beta in invasive breast cancer.
26273722 2015 A Rare Mutation in Patients With Resistance to Thyroid Hormone and Review of Therapeutic Strategies.
26041374 2015 Characteristics of patients with late manifestation of resistance thyroid hormone syndrome: a single-center experience.
26029931 2015 Thyroid Hormone Receptors Predict Prognosis in BRCA1 Associated Breast Cancer in Opposing Ways.
26003825 2015 Reduced expression of THR? in papillary thyroid carcinomas: relationship with BRAF mutation, aggressiveness and miR expression.
25924236 2015 Oncogenic mutations of thyroid hormone receptor ?.
25820519 2015 Targeting thyroid hormone receptor beta in triple-negative breast cancer.
25738994 2015 Two Novel Mutations in the Thyroid Hormone Receptor ? in Patients with Resistance to Thyroid Hormone (RTH ?): Clinical, Biochemical, and Molecular Data.
25572392 2015 Thyroid hormone receptor sumoylation is required for preadipocyte differentiation and proliferation.
25502991 2015 A family of RTH? with p.R316C mutation presenting occasional syndrome of inappropriate secretion of TSH.
25302749 2015 Association between promoter methylation and expression of thyroid hormone receptor beta (THR?) gene in patients with gastric cancer in an Iranian population.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25156012 2015 Local hypothyroidism favors the progression of preneoplastic lesions to hepatocellular carcinoma in rats.
25063548 2014 Resistance to thyroid hormone due to mutations in the THRB gene impairs bone mass and affects calcium and phosphorus homeostasis.
25019984 2014 Coordinated regulation of transcription and alternative splicing by the thyroid hormone receptor and its associating coregulators.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24849932 2014 Epigenetic regulation of thyroid hormone receptor beta in renal cancer.
24796297 2014 microRNAs 424 and 503 are mediators of the anti-proliferative and anti-invasive action of the thyroid hormone receptor beta.
24722129 Identification of four novel mutations in the thyroid hormone receptor-? gene in 164 Spanish and 2 Greek patients with resistance to thyroid hormone.
24673558 2014 The ability of thyroid hormone receptors to sense t4 as an agonist depends on receptor isoform and on cellular cofactors.
24434154 2014 Down-regulation of thyroid hormone receptor ?1 gene expression in gastric cancer involves promoter methylation.
24325866 2014 The two major isoforms of thyroid hormone receptor, TR?1 and TR?1, preferentially partner with distinct panels of auxiliary proteins.
24217081 Thyroid hormone resistance: a novel mutation in thyroid hormone receptor beta (THRB) gene - case report.
24136366 2014 The adenovirus 55 residue E1A protein is a transcriptional activator and binds the unliganded thyroid hormone receptor.
24121026 2014 T3 enhances thyroid cancer cell proliferation through TR?1/Oct-1-mediated cyclin D1 activation.
24058526 2013 Genome-wide meta-analysis of systolic blood pressure in children with sickle cell disease.
24058409 2013 Enhancer/promoter activities of the long/middle wavelength-sensitive opsins of vertebrates mediated by thyroid hormone receptor ?2 and COUP-TFII.
24036060 2013 Neuroserpin up-regulation in the Alzheimer's disease brain is associated with elevated thyroid hormone receptor-?1 and HuD expression.
23922917 2013 SIRT1 is a direct coactivator of thyroid hormone receptor ?1 with gene-specific actions.
23736295 2013 3,5-T2 is an alternative ligand for the thyroid hormone receptor ?1.
23731250 2014 Inhibition of tumorigenesis by the thyroid hormone receptor ? in xenograft models.
23629656 2013 Nuclear corepressors mediate the repression of phospholipase A2 group IIa gene transcription by thyroid hormone.
23558175 2013 Research resource: identification of novel coregulators specific for thyroid hormone receptor-?2.
23416078 2013 Thyroid hormone receptor and liver X receptor competitively up-regulate human selective Alzheimer's disease indicator-1 gene expression at the transcriptional levels.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23300972 2013 Gene specific actions of thyroid hormone receptor subtypes.
23271024 2012 Genetic features of thyroid hormone receptors.
23222517 2012 Seventy-five genetic loci influencing the human red blood cell.
23195042 2013 Thyroid hormone resistance caused by a novel deleterious variant of the thyroid hormone receptor beta gene.
23183175 2013 Reactivation of the silenced thyroid hormone receptor ? gene expression delays thyroid tumor progression.
23136537 2012 THRB genetic polymorphisms can predict severe myelotoxicity after definitive chemoradiotherapy in patients with esophageal squamous cell carcinoma.
22974658 2013 Distinct ligand-dependent and independent modes of thyroid hormone receptor (TR)/PGC-1? interaction.
22930759 2012 Thyroid hormone receptor isoform-specific modification by small ubiquitin-like modifier (SUMO) modulates thyroid hormone-dependent gene regulation.
22560525 2012 Genetic Loci implicated in erythroid differentiation and cell cycle regulation are associated with red blood cell traits.
22551329 2012 Reduced L- and M- and increased S-cone functions in an infant with thyroid hormone resistance due to mutations in the THR?2 gene.
22319036 2012 Homozygous thyroid hormone receptor ?-gene mutations in resistance to thyroid hormone: three new cases and review of the literature.
22253701 2012 Liganded thyroid hormone receptor inhibits phorbol 12-O-tetradecanoate-13-acetate-induced enhancer activity via firefly luciferase cDNA.
22212731 2013 A polymorphism in the thyroid hormone receptor gene is associated with bronchodilator response in asthmatics.
21994129 2012 Dickkopf 4 positively regulated by the thyroid hormone receptor suppresses cell invasion in human hepatoma cells.
21871106 2011 An intronic SNP in the thyroid hormone receptor ? gene is associated with pituitary cell-specific over-expression of a mutant thyroid hormone receptor ?2 (R338W) in the index case of pituitary-selective resistance to thyroid hormone.
21795843 2012 Pathogenic mechanism of mutations in the thyroid hormone receptor ? gene.
21740842 2011 A new mutation in the thyroid hormone receptor gene of a Chinese family with resistance to thyroid hormone.
21703645 2011 [Clinical and molecular study of five families with resistance to thyroid hormones].
21622534 2011 Mutant thyroid hormone receptors (TRs) isolated from distinct cancer types display distinct target gene specificities: a unique regulatory repertoire associated with two renal clear cell carcinomas.
21622532 2011 A mechanism for pituitary-resistance to thyroid hormone (PRTH) syndrome: a loss in cooperative coactivator contacts by thyroid hormone receptor (TR)beta2.
21530542 2011 Helix 12 dynamics and thyroid hormone receptor activity: experimental and molecular dynamics studies of Ile280 mutants.
21508093 2011 The oligomeric state of thyroid receptor regulates hormone binding kinetics.
21402532 2011 [The cloning, expression and the binding ability with TR?1 of retinoid X receptor-? gene].
21389087 2011 NCoR1 regulates thyroid hormone receptor isoform-dependent adipogenesis.
21323586 2011 Degradation of thyroid hormone receptor beta 1: existence of stable and unstable forms.
21159845 2011 Thyroid hormone receptor beta (THRB) is a major target gene for microRNAs deregulated in papillary thyroid carcinoma (PTC).
21110296 2010 Detection of a mutation in the thyroid hormone receptor beta gene as a cause of pathological laboratory test results in an euthyreotic toddler.
20956942 2011 Thyroid hormone receptor ?1 domains responsible for the antagonism with the ras oncogene: role of corepressors.
20838640 2010 Dissecting the Relation between a nuclear receptor and GATA: binding affinity studies of thyroid hormone receptor and GATA2 on TSH? promoter.
20827662 2011 Stanniocalcin 1 induction by thyroid hormone depends on thyroid hormone receptor ? and phosphatidylinositol 3-kinase activation.
20736347 2010 Thyroid hormone receptors are down-regulated in skeletal muscle of patients with non-thyroidal illness syndrome secondary to non-septic shock.
20716560 2010 Genetic variation within the hypothalamus-pituitary-ovarian axis in women with recurrent miscarriage.
20691434 2011 Thyroid-stimulating hormone receptor and thyroid hormone receptors are involved in human endometrial physiology.
20691260 2010 Untranslated regions of thyroid hormone receptor beta 1 mRNA are impaired in human clear cell renal cell carcinoma.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20470753 2010 Identification of a novel human thyroid hormone receptor beta isoform as a transcriptional modulator.
20444926 2010 Autoimmunity in patients with resistance to thyroid hormone.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20155399 2010 Epigenetic inactivation of the thyroid hormone receptor beta1 gene at 3p24.2 in lung cancer.
20141582 2010 Ontogenetic profile of the expression of thyroid hormone receptors in rat and human corpora cavernosa of the penis.
20139978 2010 Genome-wide association study of hematological and biochemical traits in a Japanese population.
20082849 2010 Aberrant methylation of the THRB gene in tissue and plasma of breast cancer patients.
20004952 2010 Thyroid transcription factor 1 expression in ovarian carcinomas is an independent prognostic factor.
19926848 2009 Gaining ligand selectivity in thyroid hormone receptors via entropy.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19903885 2009 Identification of CCR4 and other essential thyroid hormone receptor co-activators by modified yeast synthetic genetic array analysis.
19903799 2010 Clinical relevance of thyroid dysfunction in human haematopoiesis: biochemical and molecular studies.
19853653 2010 Establishment of yeast reporter assay systems to detect ligands of thyroid hormone receptors alpha and beta.
19628582 2009 Isoform-specific transcriptional activity of overlapping target genes that respond to thyroid hormone receptors alpha1 and beta1.
19524130 2009 The thyroid hormone receptor recruits NCoR via widely spaced receptor-interacting domains.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19439650 2009 A thyroid hormone receptor mutation that dissociates thyroid hormone regulation of gene expression in vivo.
19422879 2009 Regulation of AKR1B1 by thyroid hormone and its receptors.
19407221 2009 Thyroid hormone receptor mutations found in renal clear cell carcinomas alter corepressor release and reveal helix 12 as key determinant of corepressor specificity.
19378427 2008 Biochemical characterization of four novel mutations in the thyroid hormone receptor beta gene in patients with resistance to thyroid hormone.
19299458 2009 Aberrant histone modifications at the thyrotropin-releasing hormone gene in resistance to thyroid hormone: analysis of F455S mutant thyroid hormone receptor.
19268523 Genotyping of resistance to thyroid hormone in South American population. Identification of seven novel missense mutations in the human thyroid hormone receptor beta gene.
19211732 2009 The retinoid X receptor binding to the thyroid hormone receptor: relationship with cofactor binding and transcriptional activity.
19160403 2009 The TRbeta1 is essential in mediating T3 action on Akt pathway in human pancreatic insulinoma cells.
19000767 2008 Ligand induced interaction of thyroid hormone receptor beta with its coregulators.
18844476 2008 Identification and consequences of polymorphisms in the thyroid hormone receptor alpha and beta genes.
18798561 2009 Molecular basis for dimer formation of TRbeta variant D355R.
18683837 2008 Selective chemical rescue of a thyroid-hormone-receptor mutant, TRbeta(H435Y), identified in pituitary carcinoma and resistance to thyroid hormone.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18561095 2009 Thyroid hormone receptor beta gene mutation (P453A) in a family producing resistance to thyroid hormone.
18514160 2008 Phosphodiesterase 8B gene variants are associated with serum TSH levels and thyroid function.
18467449 2008 Thyroid hormone promotes cell invasion through activation of furin expression in human hepatoma cell lines.
18363280 2008 Resistance to thyroid hormone with missense mutation (V349M) in the thyroid hormone receptor beta gene.
18239067 2008 Thyroid hormone induces hypoxia-inducible factor 1alpha gene expression through thyroid hormone receptor beta/retinoid x receptor alpha-dependent activation of hepatic leukemia factor.
18237438 2008 Structural basis of GC-1 selectivity for thyroid hormone receptor isoforms.
17911173 2007 Lack of mutations in the thyroid hormone receptor (TR) alpha and beta genes but frequent hypermethylation of the TRbeta gene in differentiated thyroid tumors.
17827792 2007 Evaluation of thyroid hormone action in a case of generalized resistance to thyroid hormone with chronic thyroiditis: discovery of a novel heterozygous missense mutation (G347A).
17596672 2007 A newly identified insertion mutation in the thyroid hormone receptor-beta gene in a Korean family with generalized thyroid hormone resistance.
17560756 2007 Thyroid hormone receptor and IGF1/IGFR systems: possible relations in the human heart.
17418816 2007 Human spot 14 protein interacts physically and functionally with the thyroid receptor.
17293442 2007 Thyroid hormone receptor TRbeta1 mediates Akt activation by T3 in pancreatic beta cells.
17260956 2007 Low-resolution structures of thyroid hormone receptor dimers and tetramers in solution.
17177139 2006 A novel mutation (E333D) in the thyroid hormone beta receptor causing resistance to thyroid hormone syndrome.
16804041 2006 Mosaicism of a thyroid hormone receptor-beta gene mutation in resistance to thyroid hormone.
16781732 2006 Structural rearrangements in the thyroid hormone receptor hinge domain and their putative role in the receptor function.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16231318 2006 Thyroid hormone receptor beta1 in normal colon and colorectal cancer-association with differentiation, polypoid growth type and K-ras mutations.
16099238 2005 Tissue responses to thyroid hormone in a kindred with resistance to thyroid hormone harboring a commonly occurring mutation in the thyroid hormone receptor beta gene (P453T).
15987841 2005 Soy protein isolate increases hepatic thyroid hormone receptor content and inhibits its binding to target genes in rats.
15886199 2005 Rearrangements in thyroid hormone receptor charge clusters that stabilize bound 3,5',5-triiodo-L-thyronine and inhibit homodimer formation.
15867011 Cell growth effects of triiodothyronine and expression of thyroid hormone receptor in prostate carcinoma cells.
15674337 2005 Coactivation of nuclear receptors and myogenic factors induces the major BTG1 influence on muscle differentiation.
15625236 2005 p62, A TFIIH subunit, directly interacts with thyroid hormone receptor and enhances T3-mediated transcription.
15598685 2005 A de novo mutation in an already mutant nucleotide of the thyroid hormone receptor beta gene perpetuates resistance to thyroid hormone.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15466465 2004 Thyroxine-thyroid hormone receptor interactions.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15319359 2004 Unliganded thyroid hormone receptor-beta1 represses liver X receptor alpha/oxysterol-dependent transactivation.
15249124 2004 hSrb7, an essential human Mediator component, acts as a coactivator for the thyroid hormone receptor.
15186611 2004 Search for genetic variants in the retinoid X receptor-gamma-gene by polymerase chain reaction-single-strand conformation polymorphism in patients with resistance to thyroid hormone without mutations in thyroid hormone receptor beta gene.
15105435 2004 Multiple messenger ribonucleic acid variants regulate cell-specific expression of human thyroid hormone receptor beta1.
15100213 2004 Quantitative proteomics of the thyroid hormone receptor-coregulator interactions.
15080770 2004 Retarded bone growth in thyroid hormone resistance. A clinical study of a large family with a novel thyroid hormone receptor mutation.
14985366 2004 Polychlorinated biphenyls suppress thyroid hormone receptor-mediated transcription through a novel mechanism.
14767065 2004 Cell cycle-dependent expression of thyroid hormone receptor-beta is a mechanism for variable hormone sensitivity.
14761960 2004 Interaction of estrogen receptor alpha with 3-methyladenine DNA glycosylase modulates transcription and DNA repair.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14684607 2004 Thyroid hormone resistance in the heart: role of the thyroid hormone receptor beta isoform.
14673100 2003 Ligand selectivity by seeking hydrophobicity in thyroid hormone receptor.
12843201 2003 Expression of TRbeta1 mRNAs with functionally impaired mutations is rare in thyroid papillary carcinoma.
12788902 2003 Polymorphisms in thyroid hormone pathway genes are associated with plasma TSH and iodothyronine levels in healthy subjects.
12699376 2003 Thyroid receptor ligands. 1. Agonist ligands selective for the thyroid receptor beta1.
12668276 2003 Thyroid hormone receptors/THR genes in human cancer.
12554782 2003 Two resistance to thyroid hormone mutants with impaired hormone binding.
12511610 2003 Thyroid hormone receptor-beta mutations conferring hormone resistance and reduced corepressor release exhibit decreased stability in the N-terminal ligand-binding domain.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12382103 2002 Knock-in mouse model for resistance to thyroid hormone (RTH): an RTH mutation in the thyroid hormone receptor beta gene disrupts cochlear morphogenesis.
12048199 2002 Cyclin D1 Is a Ligand-independent Co-repressor for Thyroid Hormone Receptors.
12039952 2002 Identification of protein arginine methyltransferase 2 as a coactivator for estrogen receptor alpha.
12006711 2002 A novel thyroid hormone receptor-beta mutation, not anticipated to occur in resistance to thyroid hormone, causes variable phenotypes.
11971969 2002 ERAP140, a conserved tissue-specific nuclear receptor coactivator.
11929097 2002 Genetic analyses and evaluation of peripheral parameters of thyroid hormone action for the differential diagnosis of RTH. A novel heterozygous missense mutation (M334T) discovered.
11889175 2002 Functionally impaired TR mutants are present in thyroid papillary cancer.
11861164 2002 Neurodevelopmental control by thyroid hormone receptors.
11818500 2002 TR surfaces and conformations required to bind nuclear receptor corepressor.
11751919 2002 Requirement of helix 1 and the AF-2 domain of the thyroid hormone receptor for coactivation by PGC-1.
11739747 2002 Identification and characterization of a tissue-specific coactivator, GT198, that interacts with the DNA-binding domains of nuclear receptors.
11518802 2001 Aberrant alternative splicing of thyroid hormone receptor in a TSH-secreting pituitary tumor is a mechanism for hormone resistance.
11258898 2001 Thyroid hormone promotes serine phosphorylation of p53 by mitogen-activated protein kinase.
10944117 2000 Both corepressor proteins SMRT and N-CoR exist in large protein complexes containing HDAC3.
10866662 2000 A new family of nuclear receptor coregulators that integrate nuclear receptor signaling through CREB-binding protein.
10822129 2000 Expression of thyroid hormone receptors is disturbed in human renal clear cell carcinoma.
10786636 2000 Nuclear receptor binding factor-2 (NRBF-2), a possible gene activator protein interacting with nuclear hormone receptors.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10713182 2000 The orphan nuclear receptor Ear-2 is a negative coregulator for thyroid hormone nuclear receptor function.
10660344 1998 T426I a new mutation in the thyroid hormone receptor beta gene in a sporadic patient with resistance to thyroid hormone and dysmorphism. Mutations in brief no. 192. Online.
10625678 2000 An element in the region responsible for premature termination of transcription mediates repression of c-myc gene expression by thyroid hormone in neuroblastoma cells.
10567404 1999 A nuclear factor, ASC-2, as a cancer-amplified transcriptional coactivator essential for ligand-dependent transactivation by nuclear receptors in vivo.
10508171 1999 Ligand-induced recruitment of a histone deacetylase in the negative-feedback regulation of the thyrotropin beta gene.
10454579 1999 Activating signal cointegrator 1, a novel transcription coactivator of nuclear receptors, and its cytosolic localization under conditions of serum deprivation.
10207062 1999 Alien, a highly conserved protein with characteristics of a corepressor for members of the nuclear hormone receptor superfamily.
9795230 1998 Nuclear receptor binding factor-1 (NRBF-1), a protein interacting with a wide spectrum of nuclear hormone receptors.
9794455 1998 The thyrotropin beta-subunit gene is repressed by thyroid hormone in a novel thyrotrope cell line, mouse T alphaT1 cells.
9765220 1998 Hormone-induced translocation of thyroid hormone receptors in living cells visualized using a receptor green fluorescent protein chimera.
9751500 1998 Lack of coactivator interaction can be a mechanism for dominant negative activity by mutant thyroid hormone receptors.
9717844 1998 Estrogen receptor, a common interaction partner for a subset of nuclear receptors.
9405624 1997 Cloning and characterization of a corepressor and potential component of the nuclear hormone receptor repression complex.
9368056 1997 Isolation and characterization of a novel ligand-dependent thyroid hormone receptor-coactivating protein.
9325263 1997 Isolation and characterization of PBP, a protein that interacts with peroxisome proliferator-activated receptor.
9267036 1997 Nuclear receptor coactivator ACTR is a novel histone acetyltransferase and forms a multimeric activation complex with P/CAF and CBP/p300.
9171239 1997 Analysis of the functional role of steroid receptor coactivator-1 in ligand-induced transactivation by thyroid hormone receptor.
8889584 1996 Rapid molecular diagnosis of mutations associated with generalized thyroid hormone resistance by PCR-coupled automated direct sequencing of genomic DNA: detection of two novel mutations.
8664910 1996 New point mutation (R243W) in the hormone binding domain of the c-erbA beta 1 gene in a family with generalized resistance to thyroid hormone.
8514853 1993 Identical mutations in unrelated families with generalized resistance to thyroid hormone occur in cytosine-guanine-rich areas of the thyroid hormone receptor beta gene. Analysis of 15 families.
8381821 1993 An arginine to histidine mutation in codon 311 of the C-erbA beta gene results in a mutant thyroid hormone receptor that does not mediate a dominant negative phenotype.
8175986 1994 A new point mutation (C446R) in the thyroid hormone receptor-beta gene of a family with resistance to thyroid hormone.
8040303 1994 Genetic analysis of 29 kindreds with generalized and pituitary resistance to thyroid hormone. Identification of thirteen novel mutations in the thyroid hormone receptor beta gene.
7870181 1995 Interaction of thyroid-hormone receptor with a conserved transcriptional mediator.
7833659 1994 Resistance to thyroid hormone in subjects from two unrelated families is associated with a point mutation in the thyroid hormone receptor beta gene resulting in the replacement of the normal proline 453 with serine.
7776974 1995 Two classes of proteins dependent on either the presence or absence of thyroid hormone for interaction with the thyroid hormone receptor.
7746322 1995 Structural determinants of nuclear receptor assembly on DNA direct repeats.
7528740 1994 A novel C-terminal domain in the thyroid hormone receptor selectively mediates thyroid hormone inhibition.
3034496 1986 Human steroid receptors and erbA proto-oncogene products: members of a new superfamily of enhancer binding proteins.
2879243 1986 The c-erb-A gene encodes a thyroid hormone receptor.
2550353 1989 Localization of polymorphic DNA probes frequently deleted in lung carcinoma.
2510172 1989 Generalized resistance to thyroid hormone associated with a mutation in the ligand-binding domain of the human thyroid hormone receptor beta.
2254444 1990 Nuclear thyroid hormone receptors.
2153155 1990 A base mutation of the C-erbA beta thyroid hormone receptor in a kindred with generalized thyroid hormone resistance. Molecular heterogeneity in two other kindreds.
1973914 1990 Structural analysis of human thyroid hormone receptor beta gene.
1846005 1991 A new point mutation in the 3,5,3'-triiodothyronine-binding domain of the c-erbA beta thyroid hormone receptor is tightly linked to generalized thyroid hormone resistance.
1661299 1991 Characterization of seven novel mutations of the c-erbA beta gene in unrelated kindreds with generalized thyroid hormone resistance. Evidence for two "hot spot" regions of the ligand binding domain.
1657975 1991 A detailed functional and structural analysis of a major thyroid hormone inhibitory element in the human thyrotropin beta-subunit gene.
1653889 1991 A homozygous deletion in the c-erbA beta thyroid hormone receptor gene in a patient with generalized thyroid hormone resistance: isolation and characterization of the mutant receptor.
1648451 1991 The orientation and spacing of core DNA-binding motifs dictate selective transcriptional responses to three nuclear receptors.
1619012 1992 A point mutation in the 3,5,3'-triiodothyronine-binding domain of thyroid hormone receptor-beta associated with a family with generalized resistance to thyroid hormone.
1618799 1992 Thyroid hormone receptor mutants that cause resistance to thyroid hormone. Evidence for receptor competition for DNA sequences in target genes.
1587388 1992 A point mutation of the T3 receptor beta 1 gene in a kindred of generalized resistance to thyroid hormone.
1563081 1992 Functional properties of a novel mutant thyroid hormone receptor in a family with generalized thyroid hormone resistance syndrome.
1517709 1992 Distribution of the nuclear thyroid-hormone receptor in extraocular and skeletal muscles.
1425440 1992 Antipeptide polyclonal antibodies specifically recognize each human thyroid hormone receptor isoform.
1324420 1992 A point mutation (Ala229 to Thr) in the hinge domain of the c-erbA beta thyroid hormone receptor gene in a family with generalized thyroid hormone resistance.
1314846 1992 An arginine to histidine mutation in codon 315 of the c-erbA beta thyroid hormone receptor in a kindred with generalized resistance to thyroid hormones results in a receptor with significant 3,5,3'-triiodothyronine binding activity.