Property Summary

Ligand Count 210
NCBI Gene PubMed Count 222
PubMed Score 627.31
PubTator Score 407.03

Knowledge Summary

Patent (75,168)

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Peripheral vascular disease 87 0.0 3.0

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma -1.811 3.2e-03
adult high grade glioma -2.400 2.4e-03
astrocytic glioma -2.200 3.2e-03
atypical teratoid / rhabdoid tumor -4.600 7.8e-09
Becker muscular dystrophy -1.040 1.3e-02
Breast cancer -1.100 4.4e-02
breast carcinoma -1.300 5.0e-18
colon cancer -2.400 4.1e-09
cystic fibrosis -3.066 2.1e-06
ductal carcinoma in situ -1.600 1.0e-03
ependymoma -2.200 4.0e-02
glioblastoma -1.900 5.1e-04
group 3 medulloblastoma -4.300 2.4e-04
head and neck cancer -1.200 2.5e-04
hereditary spastic paraplegia -1.034 2.2e-02
interstitial cystitis -2.200 2.6e-04
intraductal papillary-mucinous adenoma (... 1.400 1.8e-02
invasive ductal carcinoma -1.676 1.1e-04
lung cancer -1.100 2.6e-03
lung carcinoma -1.300 3.9e-17
medulloblastoma, large-cell -5.500 2.4e-06
oligodendroglioma -1.800 1.3e-02
osteosarcoma 1.254 2.2e-06
ovarian cancer 1.200 3.6e-03
primitive neuroectodermal tumor -3.700 2.8e-04
psoriasis 1.200 4.3e-04
ulcerative colitis -1.300 1.0e-02

Protein-protein Interaction (6)

Gene RIF (147)

AA Sequence

MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHL      1 - 70
DHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLH     71 - 140
PSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGH    141 - 210
KPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFSHFTKIITPAI    211 - 280
TRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVRYDPESETLTLNGEMAVTRGQLKNGGLGVVS    281 - 350
DAIFDLGMSLSSFNLDDTEVALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK    351 - 420
LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED                                 421 - 461
//

Text Mined References (228)

PMID Year Title