Property Summary

NCBI Gene PubMed Count 11
PubMed Score 50.08
PubTator Score 9.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (2)

Disease log2 FC p
malignant mesothelioma 1.700 3.6e-06
group 3 medulloblastoma 1.400 1.1e-02

 GO Function (1)

Protein-protein Interaction (6)

Gene RIF (5)

PMID Text
22174317 HIV-1 Rev interacting protein, THO complex 6 homolog (THOC6), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells. The interaction of Rev with THOC6 is decreased by RRE
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19773279 Observational study of gene-disease association. (HuGE Navigator)
18976975 Knockdown of THO complex 6 homolog (THOC6) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells

AA Sequence

MERAVPLAVPLGQTEVFQALQRLHMTIFSQSVSPCGKFLAAGNNYGQIAIFSLSSALSSEAKEESKKPVV      1 - 70
TFQAHDGPVYSMVSTDRHLLSAGDGEVKAWLWAEMLKKGCKELWRRQPPYRTSLEVPEINALLLVPKENS     71 - 140
LILAGGDCQLHTMDLETGTFTRVLRGHTDYIHCLALRERSPEVLSGGEDGAVRLWDLRTAKEVQTIEVYK    141 - 210
HEECSRPHNGRWIGCLATDSDWMVCGGGPALTLWHLRSSTPTTIFPIRAPQKHVTFYQDLILSAGQGRCV    211 - 280
NQWQLSGELKAQVPGSSPGLLSLSLNQQPAAPECKVLTAAGNSCRVDVFTNLGYRAFSLSF             281 - 341
//

Text Mined References (14)

PMID Year Title
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23621916 2013 Intellectual disability associated with a homozygous missense mutation in THOC6.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19773279 2009 Association between genetic variants in VEGF, ERCC3 and occupational benzene haematotoxicity.
18974867 2008 Recruitment of the complete hTREX complex is required for Kaposi's sarcoma-associated herpesvirus intronless mRNA nuclear export and virus replication.
17190602 2006 Human mRNA export machinery recruited to the 5' end of mRNA.
15998806 2005 Recruitment of the human TREX complex to mRNA during splicing.
15833825 2005 Linking transcriptional elongation and messenger RNA export to metastatic breast cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.