Property Summary

NCBI Gene PubMed Count 34
PubMed Score 16.79
PubTator Score 21.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
group 3 medulloblastoma 2254 7.1e-04
ovarian cancer 8491 8.4e-04
lung cancer 4473 1.4e-03
osteosarcoma 7933 2.7e-03
malignant mesothelioma 3163 3.2e-03

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.100 3.2e-03
osteosarcoma -1.262 2.7e-03
lung cancer 1.400 1.4e-03
group 3 medulloblastoma 1.100 7.1e-04
ovarian cancer 1.200 8.4e-04

 GO Function (1)

 GWAS Trait (1)

Gene RIF (7)

PMID Text
24023261 THOC5 to be a novel gene involved in the regulation of serum HDL-C levels
23685434 Authors suggest a model in which human Thoc5 controls polyadenylation site choice through the co-transcriptional loading of CFIm68 onto target genes.
23032722 show that THOC5 Y225 phosphorylation governs mRNA binding. In addition, CXCL12 is shown to induce THOC5 Y225 phosphorylation, and site-directed mutagenesis demonstrates that this modulates motile response
21937706 show here that DNA damage drastically decreased the cytoplasmic pool of a set of THOC5-dependent mRNAs and impaired the THOC5/mRNA complex formation
19165146 Thoc5 exhibits in vitro RNA-binding activity and is associated with HSP70 mRNPs in vivo as a component of the stable THO complex
19059247 THOC7 (50-137, amino acid numbers) binds to the N-terminal portion (1-199) of FMIP directly.
19015024 THOC5 protein expression can potentiate receptor signalling to transcription factor expression and monocyte differentiation.

AA Sequence

MSSESSKKRKPKVIRSDGAPAEGKRNRSDTEQEGKYYSEEAEVDLRDPGRDYELYKYTCQELQRLMAEIQ      1 - 70
DLKSRGGKDVAIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHEAKQKVDAYHLQLQNLLYEVMHL     71 - 140
QKEITKCLEFKSKHEEIDLVSLEEFYKEAPPDISKAEVTMGDPHQQTLARLDWELEQRKRLAEKYRECLS    141 - 210
NKEKILKEIEVKKEYLSSLQPRLNSIMQASLPVQEYLFMPFDQAHKQYETARHLPPPLYVLFVQATAYGQ    211 - 280
ACDKTLSVAIEGSVDEAKALFKPPEDSQDDESDSDAEEEQTTKRRRPTLGVQLDDKRKEMLKRHPLSVML    281 - 350
DLKCKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQY    351 - 420
QFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALH    421 - 490
KQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTVAHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGT    491 - 560
AKLQAAVVLNPGYSSIPPVFQLCLNWKGEKTNSNDDNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLC    561 - 630
VLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR                     631 - 683
//

Text Mined References (47)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26382858 2015 mRNA export through an additional cap-binding complex consisting of NCBP1 and NCBP3.
25662211 2015 Luzp4 defines a new mRNA export pathway in cancer cells.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
24023261 2013 THOC5: a novel gene involved in HDL-cholesterol metabolism.
23685434 2013 Human TREX component Thoc5 affects alternative polyadenylation site choice by recruiting mammalian cleavage factor I.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23032722 2013 A pathway from leukemogenic oncogenes and stem cell chemokines to RNA processing via THOC5.
22893130 2012 TREX exposes the RNA-binding domain of Nxf1 to enable mRNA export.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22365833 2012 Dynamic protein-protein interaction wiring of the human spliceosome.
22144908 2011 Genome instability and transcription elongation impairment in human cells depleted of THO/TREX.
21937706 2011 An ataxia-telangiectasia-mutated (ATM) kinase mediated response to DNA damage down-regulates the mRNA-binding potential of THOC5.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20009918 2010 A genome-wide association study of carotid atherosclerosis in HIV-infected men.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19165146 2009 Adaptor Aly and co-adaptor Thoc5 function in the Tap-p15-mediated nuclear export of HSP70 mRNA.
19059247 2009 Nuclear localization of the pre-mRNA associating protein THOC7 depends upon its direct interaction with Fms tyrosine kinase interacting protein (FMIP).
19015024 2009 THOC5 couples M-CSF receptor signaling to transcription factor expression.
18974867 2008 Recruitment of the complete hTREX complex is required for Kaposi's sarcoma-associated herpesvirus intronless mRNA nuclear export and virus replication.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18373705 2008 THOC5 spliceosome protein: a target for leukaemogenic tyrosine kinases that affects inositol lipid turnover.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17525332 2007 ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.
17190602 2006 Human mRNA export machinery recruited to the 5' end of mRNA.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
15998806 2005 Recruitment of the human TREX complex to mRNA during splicing.
15833825 2005 Linking transcriptional elongation and messenger RNA export to metastatic breast cancers.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15221008 2004 The M-CSF receptor substrate and interacting protein FMIP is governed in its subcellular localization by protein kinase C-mediated phosphorylation, and thereby potentiates M-CSF-mediated differentiation.
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11979277 2002 TREX is a conserved complex coupling transcription with messenger RNA export.
10597251 1999 FMIP, a novel Fms-interacting protein, affects granulocyte/macrophage differentiation.
10591208 1999 The DNA sequence of human chromosome 22.
10231032 1999 Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8242058 1993 Cloning of a novel, anonymous gene from a megabase-range YAC and cosmid contig in the neurofibromatosis type 2/meningioma region on human chromosome 22q12.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.