Property Summary

NCBI Gene PubMed Count 35
PubMed Score 16.85
PubTator Score 21.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
group 3 medulloblastoma 4104 7.1e-04
ovarian cancer 8520 8.4e-04
lung cancer 4740 1.4e-03
osteosarcoma 7950 2.7e-03
malignant mesothelioma 3232 3.2e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.100 7.1e-04
lung cancer 1.400 1.4e-03
malignant mesothelioma 1.100 3.2e-03
osteosarcoma -1.262 2.7e-03
ovarian cancer 1.200 8.4e-04

 GO Function (1)

 GWAS Trait (1)

Gene RIF (8)

AA Sequence

MSSESSKKRKPKVIRSDGAPAEGKRNRSDTEQEGKYYSEEAEVDLRDPGRDYELYKYTCQELQRLMAEIQ      1 - 70
DLKSRGGKDVAIEIEERRIQSCVHFMTLKKLNRLAHIRLKKGRDQTHEAKQKVDAYHLQLQNLLYEVMHL     71 - 140
QKEITKCLEFKSKHEEIDLVSLEEFYKEAPPDISKAEVTMGDPHQQTLARLDWELEQRKRLAEKYRECLS    141 - 210
NKEKILKEIEVKKEYLSSLQPRLNSIMQASLPVQEYLFMPFDQAHKQYETARHLPPPLYVLFVQATAYGQ    211 - 280
ACDKTLSVAIEGSVDEAKALFKPPEDSQDDESDSDAEEEQTTKRRRPTLGVQLDDKRKEMLKRHPLSVML    281 - 350
DLKCKDDSVLHLTFYYLMNLNIMTVKAKVTTAMELITPISAGDLLSPDSVLSCLYPGDHGKKTPNPANQY    351 - 420
QFDKVGILTLSDYVLELGHPYLWVQKLGGLHFPKEQPQQTVIADHSLSASHMETTMKLLKTRVQSRLALH    421 - 490
KQFASLEHGIVPVTSDCQYLFPAKVVSRLVKWVTVAHEDYMELHFTKDIVDAGLAGDTNLYYMALIERGT    491 - 560
AKLQAAVVLNPGYSSIPPVFQLCLNWKGEKTNSNDDNIRAMEGEVNVCYKELCGPWPSHQLLTNQLQRLC    561 - 630
VLLDVYLETESHDDSVEGPKEFPQEKMCLRLFRGPSRMKPFKYNHPQGFFSHR                     631 - 683
//

Text Mined References (49)

PMID Year Title